KEGG   Ailuropoda melanoleuca (giant panda): 100469441Help
Entry
100469441         CDS       T01329                                 

Definition
arginase-2, mitochondrial-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aml01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aml00330]
Human Diseases; Infectious diseases; Amoebiasis [PATH:aml05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 354 aa AA seqDB search
MSVSSSLSRLLRTRVHSVLKKSVHSVAVIGAPFSQGQKRKGVEYGPAAVREAGLMKRLSS
LGCRLKDFGDLSFTPVPKDDLYKNLIVNPRSVGLANQELAEVVSRAVSSGYSCVTVGGDH
SLAIGTISGHARQCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIA
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYITEEIHNTGLLSALDLVEVNPQ
LAASEEEAKATASLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESEREERARI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgagcagcagcctctcgcgtctcctccggacgcgagtgcattctgtcctgaag
aagtccgttcattcggtggctgtgatcggagccccattctcccagggacagaaaagaaaa
ggagtggagtatggtcctgctgccgtaagagaagctggcttgatgaaaagactctccagt
ttgggctgccgcctaaaggattttggagatttgagttttactccagtccctaaagatgat
ctctacaagaacctgatagtgaatcctcgctcagtgggccttgccaaccaggaactagct
gaggtggttagtagagccgtgtcaagtggctacagctgtgtcacagtgggaggagaccac
agcctggcaatcggtaccattagtggccacgcccggcagtgcccagacctttgtgtgatc
tgggttgatgcccatgctgatatcaatacacccctcaccacttcatctggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtaccacaactcccagga
ttttcctggatcaaaccttgtatctcctccccaagtattgtgtatattggtctgagagac
gtggaccctcctgaacattttattttaaagaattatgatatccagtatttctccatgaga
gacatagatcgacttggtattcagaaagtcatggaacagacatttgatctgctaattgcc
aaaagacaaaggccaatccatctgagttttgatattgatgcattcgaccctaccctggct
ccagccacaggaacccctgttgtagggggactgacctatcgagaaggcatgtatattact
gaggaaatacacaacacagggttgctgtcagcactggacctcgttgaagtcaatcctcag
ttggctgcttcagaggaagaggccaaggctacagctagcctggcagtggatgtgattgct
tcaagttttggtcagacaagggagggagggcacattgtctatgaccaacttcctactccc
agttcaccagatgaatcagaaagggaagaacgtgcaagaatttag

DBGET integrated database retrieval system