KEGG   Ailuropoda melanoleuca (giant panda): 100469597Help
Entry
100469597         CDS       T01329                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100469597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 284 aa AA seqDB search
MPGARSGGPGRGGXXXGDYSGDASGAVTVWEVVSLLGKLLGTVAALKVVLYLLRVCLAMA
SGGPSHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHM
HAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGSSGKVIGIDHIKELVEDSVNNVR
KDDPLLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVG
PAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRDEL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgccgggagcgcgcagtggcggccccggccggggggggnnnnnnnnnggagactacagc
ggggacgcgagcggggcggtgaccgtgtgggaggtggtctcactcttggggaagctgctg
ggcaccgtcgccgcgctgaaggtggttctgtacctgctccgggtgtgcttagcgatggca
tccggtggccccagccactcggagctaatccacaatctccgcaaaaatggaatcatcaaa
acagataaagtatttgaagtaatgctggccacagaccgttcccactatgcaaaatgtaat
ccttatatggattctccacaatcaataggtttccaagcaacaatcagtgctccacacatg
catgcatatgcactagaacttctatttgatcagttgcatgaaggagctaaagctctcgat
gtgggatctggaagtggaatccttactgcatgttttgcacgtatggttggctctagtgga
aaagtcataggaattgaccacattaaagagctagtagaagactcagtaaataatgtcaga
aaggacgatccactgcttttgtcttcagggagagtccagctggttgtgggggatggaaga
atgggatatgccgaagaagccccttatgatgctattcacgtaggagctgcagccccagtt
gtgccccaggcactgatagaccagttaaagcctggtggcagattgatattgccagttggt
cccgcaggtggaaaccagatgttggagcagtatgacaagctacaggacggcagtgtcaag
atgaaacccctgatgggagtgatatacgtgcctttaacagataaagagaagcagtggtcc
agggatgaactgtaa

DBGET integrated database retrieval system