KEGG   Ailuropoda melanoleuca (giant panda): 100469600Help
Entry
100469600         CDS       T01329                                 

Gene name
AURKA
Definition
aurora kinase A
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100469600 (AURKA)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100469600 (AURKA)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100469600 (AURKA)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100469600 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 405 aa AA seqDB search
MDRSKENCIAGPLKTTVGLGDGPKRVLVTQQIPSQNPLSANSGQAQRVLCPSNSSQRVPP
QAQKLVSSHKPVQNLKQKQLQATSVPRPVSRPLNNTQKNEQASSSAPGNNSEKELATKQK
NEESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITE
LADALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPE
MIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEASTYQETYKRISRVEFTFPDFVPEGARDL
ISRLLKHNPSQRPTLKEVLEHPWITANSSKPSSSQKSKESASKQS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacagatctaaagaaaactgcattgcagggcctcttaagactacagttggacttggt
gatggtccaaaacgtgttctggtgactcagcaaattccttctcagaatccgttatctgca
aatagtggccaggcccagcgggtcttgtgtccttcaaattcctcccagcgagttcctcca
caagcacaaaagctcgtctccagccataaaccagttcagaatctgaagcagaagcaattg
caggccaccagtgtccctcgtcctgtctctaggccactgaataatacccaaaagaatgag
caagcatcatcatcagcccctggaaataattctgaaaaggaactggcaacgaaacagaaa
aatgaagaatcaaaaaaaaggcaatgggctttggaagattttgaaattggtcgtcccctg
ggtaaaggaaagtttggtaatgtttacttggcgagagaaaaacaaagcaagtttatcctg
gctcttaaagtattatttaaagctcaactggagaaggcaggagttgagcatcagctgaga
agagaagtagaaatacagtcccaccttaggcatccaaatattctcagactctatggttat
ttccatgatgccaccagagtttacctaattctagaatatgcgcctctgggagctgtctac
agggaacttcagaaactgtcaaagtttgatgagcagagaactgctacttatatcacagag
ttggcagatgccctgtcttactgtcactcaaagagagtcattcatagagacattaagcca
gagaacctactccttggatcggctggagagcttaagattgcagattttgggtggtcggta
catgccccatcctccaggagaaccaccctgtgcggcaccctggattacttgcccccagag
atgattgaaggccgaatgcatgacgagaaggtggatctctggagccttggggttctttgc
tatgaatttctagttgggaagcctccttttgaggcaagcacatatcaagagacctacaaa
agaatatcgcgggttgaattcacattccctgacttcgtgccggagggagccagggacctc
atttcaagactgttgaaacataatcccagccaaaggccgactctcaaagaagtacttgaa
cacccctggatcacagcaaattcatcaaagccatcaagtagccaaaaaagcaaagaatca
gctagcaaacaatcttga

DBGET integrated database retrieval system