KEGG   Ailuropoda melanoleuca (giant panda): 100469600Help
Entry
100469600         CDS       T01329                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100469600 (AURKA)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100469600 (AURKA)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100469600 (AURKA)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100469600 (AURKA)
Chromosome [BR:aml03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100469600 (AURKA)
   Spindle formation proteins
    100469600 (AURKA)
  Sister chromatid separation proteins
   Aurora kinases
    100469600 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 405 aa AA seqDB search
MDRSKENCIAGPLKTTVGLGDGPKRVLVTQQIPSQNPLSANSGQAQRVLCPSNSSQRVPP
QAQKLVSSHKPVQNLKQKQLQATSVPRPVSRPLNNTQKNEQASSSAPGNNSEKELATKQK
NEESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLR
REVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGAVYRELQKLSKFDEQRTATYITE
LADALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPE
MIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEASTYQETYKRISRVEFTFPDFVPEGARDL
ISRLLKHNPSQRPTLKEVLEHPWITANSSKPSSSQKSKESASKQS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacagatctaaagaaaactgcattgcagggcctcttaagactacagttggacttggt
gatggtccaaaacgtgttctggtgactcagcaaattccttctcagaatccgttatctgca
aatagtggccaggcccagcgggtcttgtgtccttcaaattcctcccagcgagttcctcca
caagcacaaaagctcgtctccagccataaaccagttcagaatctgaagcagaagcaattg
caggccaccagtgtccctcgtcctgtctctaggccactgaataatacccaaaagaatgag
caagcatcatcatcagcccctggaaataattctgaaaaggaactggcaacgaaacagaaa
aatgaagaatcaaaaaaaaggcaatgggctttggaagattttgaaattggtcgtcccctg
ggtaaaggaaagtttggtaatgtttacttggcgagagaaaaacaaagcaagtttatcctg
gctcttaaagtattatttaaagctcaactggagaaggcaggagttgagcatcagctgaga
agagaagtagaaatacagtcccaccttaggcatccaaatattctcagactctatggttat
ttccatgatgccaccagagtttacctaattctagaatatgcgcctctgggagctgtctac
agggaacttcagaaactgtcaaagtttgatgagcagagaactgctacttatatcacagag
ttggcagatgccctgtcttactgtcactcaaagagagtcattcatagagacattaagcca
gagaacctactccttggatcggctggagagcttaagattgcagattttgggtggtcggta
catgccccatcctccaggagaaccaccctgtgcggcaccctggattacttgcccccagag
atgattgaaggccgaatgcatgacgagaaggtggatctctggagccttggggttctttgc
tatgaatttctagttgggaagcctccttttgaggcaagcacatatcaagagacctacaaa
agaatatcgcgggttgaattcacattccctgacttcgtgccggagggagccagggacctc
atttcaagactgttgaaacataatcccagccaaaggccgactctcaaagaagtacttgaa
cacccctggatcacagcaaattcatcaaagccatcaagtagccaaaaaagcaaagaatca
gctagcaaacaatcttga

DBGET integrated database retrieval system