KEGG   Ailuropoda melanoleuca (giant panda): 100469628Help
Entry
100469628         CDS       T01329                                 

Definition
cAMP-dependent protein kinase catalytic subunit beta-like
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100469628
   04010 MAPK signaling pathway
    100469628
   04310 Wnt signaling pathway
    100469628
   04340 Hedgehog signaling pathway
    100469628
   04020 Calcium signaling pathway
    100469628
   04024 cAMP signaling pathway
    100469628
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100469628
   04210 Apoptosis
    100469628
  Cellular commiunity
   04540 Gap junction
    100469628
 Organismal Systems
  Immune system
   04611 Platelet activation
    100469628
   04062 Chemokine signaling pathway
    100469628
  Endocrine system
   04911 Insulin secretion
    100469628
   04910 Insulin signaling pathway
    100469628
   04912 GnRH signaling pathway
    100469628
   04913 Ovarian Steroidogenesis
    100469628
   04915 Estrogen signaling pathway
    100469628
   04914 Progesterone-mediated oocyte maturation
    100469628
   04921 Oxytocin signaling pathway
    100469628
   04918 Thyroid hormone synthesis
    100469628
   04919 Thyroid hormone signaling pathway
    100469628
   04916 Melanogenesis
    100469628
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100469628
   04270 Vascular smooth muscle contraction
    100469628
  Digestive system
   04970 Salivary secretion
    100469628
   04971 Gastric acid secretion
    100469628
   04976 Bile secretion
    100469628
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100469628
   04961 Endocrine and other factor-regulated calcium reabsorption
    100469628
  Nervous system
   04724 Glutamatergic synapse
    100469628
   04727 GABAergic synapse
    100469628
   04725 Cholinergic synapse
    100469628
   04728 Dopaminergic synapse
    100469628
   04726 Serotonergic synapse
    100469628
   04720 Long-term potentiation
    100469628
   04723 Retrograde endocannabinoid signaling
    100469628
  Sensory system
   04740 Olfactory transduction
    100469628
   04742 Taste transduction
    100469628
   04750 Inflammatory mediator regulation of TRP channels
    100469628
  Environmental adaptation
   04713 Circadian entrainment
    100469628
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100469628
   05205 Proteoglycans in cancer
    100469628
   05203 Viral carcinogenesis
    100469628
  Neurodegenerative diseases
   05012 Parkinson's disease
    100469628
   05020 Prion diseases
    100469628
  Substance dependence
   05030 Cocaine addiction
    100469628
   05031 Amphetamine addiction
    100469628
   05032 Morphine addiction
    100469628
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100469628
  Infectious diseases
   05166 HTLV-I infection
    100469628
   05169 Epstein-Barr virus infection
    100469628
   05146 Amoebiasis
    100469628
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100469628
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100469628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 397 aa AA seqDB search
MAAYKELPCNQYTGTTALQKLEGFASRLFHRHSKSTAHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFCEF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttataaagaactaccctgtaaccagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacattctaaaagtactgcacatgatcag
aaaactgctctggaaaatgacagccttcatttctctgaacatactgctttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttcttaaaaaatgggaaaatcct
gctccgaataatgctggactggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcataccttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtactcttttaaggataat
tctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcccatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaagggtatatccaggttacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagagataatcctcagcaag
ggctacaataaggcagtggattggtgggcattaggtgtgttaatctatgaaatggcagct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttctgga
aaggtccgattcccatcgcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggatttgacgaagcggtttggaaacctgaagaatggtgtgagtgatataaaaact
cacaagtggtttgccaccacagattggattgctatttaccagaggaaggttgaagcacca
ttcataccaaagttcagaggctctggagataccagcaacttcgatgactatgaagaagaa
gatatccgcgtctctataacagaaaaatgtgcaaaagagttttgtgaattttaa

DBGET integrated database retrieval system