KEGG   Ailuropoda melanoleuca (giant panda): 100469628Help
Entry
100469628         CDS       T01329                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase, cAMP-dependent, catalytic, beta
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100469628 (PRKACB)
   04010 MAPK signaling pathway
    100469628 (PRKACB)
   04310 Wnt signaling pathway
    100469628 (PRKACB)
   04340 Hedgehog signaling pathway
    100469628 (PRKACB)
   04020 Calcium signaling pathway
    100469628 (PRKACB)
   04024 cAMP signaling pathway
    100469628 (PRKACB)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100469628 (PRKACB)
  Cellular commiunity
   04540 Gap junction
    100469628 (PRKACB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100469628 (PRKACB)
   04062 Chemokine signaling pathway
    100469628 (PRKACB)
  Endocrine system
   04911 Insulin secretion
    100469628 (PRKACB)
   04910 Insulin signaling pathway
    100469628 (PRKACB)
   04922 Glucagon signaling pathway
    100469628 (PRKACB)
   04923 Regulation of lipolysis in adipocyte
    100469628 (PRKACB)
   04912 GnRH signaling pathway
    100469628 (PRKACB)
   04913 Ovarian Steroidogenesis
    100469628 (PRKACB)
   04915 Estrogen signaling pathway
    100469628 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100469628 (PRKACB)
   04921 Oxytocin signaling pathway
    100469628 (PRKACB)
   04918 Thyroid hormone synthesis
    100469628 (PRKACB)
   04919 Thyroid hormone signaling pathway
    100469628 (PRKACB)
   04916 Melanogenesis
    100469628 (PRKACB)
   04924 Renin secretion
    100469628 (PRKACB)
   04925 Aldosterone synthesis and secretion
    100469628 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100469628 (PRKACB)
   04270 Vascular smooth muscle contraction
    100469628 (PRKACB)
  Digestive system
   04970 Salivary secretion
    100469628 (PRKACB)
   04971 Gastric acid secretion
    100469628 (PRKACB)
   04976 Bile secretion
    100469628 (PRKACB)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100469628 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100469628 (PRKACB)
  Nervous system
   04724 Glutamatergic synapse
    100469628 (PRKACB)
   04727 GABAergic synapse
    100469628 (PRKACB)
   04725 Cholinergic synapse
    100469628 (PRKACB)
   04728 Dopaminergic synapse
    100469628 (PRKACB)
   04726 Serotonergic synapse
    100469628 (PRKACB)
   04720 Long-term potentiation
    100469628 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    100469628 (PRKACB)
  Sensory system
   04740 Olfactory transduction
    100469628 (PRKACB)
   04742 Taste transduction
    100469628 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    100469628 (PRKACB)
  Aging
   04211 Longevity regulating pathway - mammal
    100469628 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    100469628 (PRKACB)
  Environmental adaptation
   04713 Circadian entrainment
    100469628 (PRKACB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100469628 (PRKACB)
   05205 Proteoglycans in cancer
    100469628 (PRKACB)
   05203 Viral carcinogenesis
    100469628 (PRKACB)
  Neurodegenerative diseases
   05012 Parkinson's disease
    100469628 (PRKACB)
   05020 Prion diseases
    100469628 (PRKACB)
  Substance dependence
   05030 Cocaine addiction
    100469628 (PRKACB)
   05031 Amphetamine addiction
    100469628 (PRKACB)
   05032 Morphine addiction
    100469628 (PRKACB)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100469628 (PRKACB)
  Infectious diseases
   05166 HTLV-I infection
    100469628 (PRKACB)
   05169 Epstein-Barr virus infection
    100469628 (PRKACB)
   05146 Amoebiasis
    100469628 (PRKACB)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100469628 (PRKACB)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100469628 (PRKACB)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100469628 (PRKACB)
Chromosome [BR:aml03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100469628 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 397 aa AA seqDB search
MAAYKELPCNQYTGTTALQKLEGFASRLFHRHSKSTAHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFCEF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttataaagaactaccctgtaaccagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacattctaaaagtactgcacatgatcag
aaaactgctctggaaaatgacagccttcatttctctgaacatactgctttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttcttaaaaaatgggaaaatcct
gctccgaataatgctggactggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcataccttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtactcttttaaggataat
tctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcccatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaagggtatatccaggttacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagagataatcctcagcaag
ggctacaataaggcagtggattggtgggcattaggtgtgttaatctatgaaatggcagct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttctgga
aaggtccgattcccatcgcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggatttgacgaagcggtttggaaacctgaagaatggtgtgagtgatataaaaact
cacaagtggtttgccaccacagattggattgctatttaccagaggaaggttgaagcacca
ttcataccaaagttcagaggctctggagataccagcaacttcgatgactatgaagaagaa
gatatccgcgtctctataacagaaaaatgtgcaaaagagttttgtgaattttaa

DBGET integrated database retrieval system