KEGG   Ailuropoda melanoleuca (giant panda): 100469628Help
Entry
100469628         CDS       T01329                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04020  Calcium signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04114  Oocyte meiosis
aml04140  Autophagy - animal
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04310  Wnt signaling pathway
aml04340  Hedgehog signaling pathway
aml04371  Apelin signaling pathway
aml04530  Tight junction
aml04540  Gap junction
aml04611  Platelet activation
aml04713  Circadian entrainment
aml04714  Thermogenesis
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04727  GABAergic synapse
aml04728  Dopaminergic synapse
aml04740  Olfactory transduction
aml04742  Taste transduction
aml04750  Inflammatory mediator regulation of TRP channels
aml04910  Insulin signaling pathway
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04913  Ovarian steroidogenesis
aml04914  Progesterone-mediated oocyte maturation
aml04915  Estrogen signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04922  Glucagon signaling pathway
aml04923  Regulation of lipolysis in adipocytes
aml04924  Renin secretion
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04927  Cortisol synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04934  Cushing's syndrome
aml04961  Endocrine and other factor-regulated calcium reabsorption
aml04962  Vasopressin-regulated water reabsorption
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04976  Bile secretion
aml05012  Parkinson's disease
aml05020  Prion diseases
aml05030  Cocaine addiction
aml05031  Amphetamine addiction
aml05032  Morphine addiction
aml05146  Amoebiasis
aml05165  Human papillomavirus infection
aml05166  HTLV-I infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05205  Proteoglycans in cancer
aml05414  Dilated cardiomyopathy (DCM)
Module
aml_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100469628 (PRKACB)
   04010 MAPK signaling pathway
    100469628 (PRKACB)
   04310 Wnt signaling pathway
    100469628 (PRKACB)
   04340 Hedgehog signaling pathway
    100469628 (PRKACB)
   04371 Apelin signaling pathway
    100469628 (PRKACB)
   04020 Calcium signaling pathway
    100469628 (PRKACB)
   04024 cAMP signaling pathway
    100469628 (PRKACB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100469628 (PRKACB)
  Cell growth and death
   04114 Oocyte meiosis
    100469628 (PRKACB)
  Cellular community - eukaryotes
   04530 Tight junction
    100469628 (PRKACB)
   04540 Gap junction
    100469628 (PRKACB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100469628 (PRKACB)
   04062 Chemokine signaling pathway
    100469628 (PRKACB)
  Endocrine system
   04911 Insulin secretion
    100469628 (PRKACB)
   04910 Insulin signaling pathway
    100469628 (PRKACB)
   04922 Glucagon signaling pathway
    100469628 (PRKACB)
   04923 Regulation of lipolysis in adipocyte
    100469628 (PRKACB)
   04912 GnRH signaling pathway
    100469628 (PRKACB)
   04913 Ovarian Steroidogenesis
    100469628 (PRKACB)
   04915 Estrogen signaling pathway
    100469628 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    100469628 (PRKACB)
   04921 Oxytocin signaling pathway
    100469628 (PRKACB)
   04926 Relaxin signaling pathway
    100469628 (PRKACB)
   04918 Thyroid hormone synthesis
    100469628 (PRKACB)
   04919 Thyroid hormone signaling pathway
    100469628 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    100469628 (PRKACB)
   04916 Melanogenesis
    100469628 (PRKACB)
   04924 Renin secretion
    100469628 (PRKACB)
   04925 Aldosterone synthesis and secretion
    100469628 (PRKACB)
   04927 Cortisol synthesis and secretion
    100469628 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100469628 (PRKACB)
   04270 Vascular smooth muscle contraction
    100469628 (PRKACB)
  Digestive system
   04970 Salivary secretion
    100469628 (PRKACB)
   04971 Gastric acid secretion
    100469628 (PRKACB)
   04976 Bile secretion
    100469628 (PRKACB)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    100469628 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100469628 (PRKACB)
  Nervous system
   04724 Glutamatergic synapse
    100469628 (PRKACB)
   04727 GABAergic synapse
    100469628 (PRKACB)
   04725 Cholinergic synapse
    100469628 (PRKACB)
   04728 Dopaminergic synapse
    100469628 (PRKACB)
   04726 Serotonergic synapse
    100469628 (PRKACB)
   04720 Long-term potentiation
    100469628 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    100469628 (PRKACB)
  Sensory system
   04740 Olfactory transduction
    100469628 (PRKACB)
   04742 Taste transduction
    100469628 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    100469628 (PRKACB)
  Aging
   04211 Longevity regulating pathway - mammal
    100469628 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    100469628 (PRKACB)
  Environmental adaptation
   04713 Circadian entrainment
    100469628 (PRKACB)
   04714 Thermogenesis
    100469628 (PRKACB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100469628 (PRKACB)
   05205 Proteoglycans in cancer
    100469628 (PRKACB)
   05203 Viral carcinogenesis
    100469628 (PRKACB)
  Neurodegenerative diseases
   05012 Parkinson's disease
    100469628 (PRKACB)
   05020 Prion diseases
    100469628 (PRKACB)
  Substance dependence
   05030 Cocaine addiction
    100469628 (PRKACB)
   05031 Amphetamine addiction
    100469628 (PRKACB)
   05032 Morphine addiction
    100469628 (PRKACB)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    100469628 (PRKACB)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    100469628 (PRKACB)
  Infectious diseases
   05166 HTLV-I infection
    100469628 (PRKACB)
   05169 Epstein-Barr virus infection
    100469628 (PRKACB)
   05165 Human papillomavirus infection
    100469628 (PRKACB)
   05146 Amoebiasis
    100469628 (PRKACB)
  Drug resistance
   01522 Endocrine resistance
    100469628 (PRKACB)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100469628 (PRKACB)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  PKA family
   100469628 (PRKACB)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100469628 (PRKACB)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100469628 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 100469628
NCBI-ProteinID: XP_002926859
Ensembl: ENSAMEG00000013506
UniProt: D2HVX2
Position
Un
AA seq 397 aa AA seqDB search
MAAYKELPCNQYTGTTALQKLEGFASRLFHRHSKSTAHDQKTALENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFCEF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttataaagaactaccctgtaaccagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacattctaaaagtactgcacatgatcag
aaaactgctctggaaaatgacagccttcatttctctgaacatactgctttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttcttaaaaaatgggaaaatcct
gctccgaataatgctggactggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcataccttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtactcttttaaggataat
tctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcccatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaagggtatatccaggttacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagagataatcctcagcaag
ggctacaataaggcagtggattggtgggcattaggtgtgttaatctatgaaatggcagct
ggctaccccccattctttgcagaccaaccaattcagatttatgaaaagattgtttctgga
aaggtccgattcccatcgcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggatttgacgaagcggtttggaaacctgaagaatggtgtgagtgatataaaaact
cacaagtggtttgccaccacagattggattgctatttaccagaggaaggttgaagcacca
ttcataccaaagttcagaggctctggagataccagcaacttcgatgactatgaagaagaa
gatatccgcgtctctataacagaaaaatgtgcaaaagagttttgtgaattttaa

DBGET integrated database retrieval system