KEGG   Ailuropoda melanoleuca (giant panda): 100469654Help
Entry
100469654         CDS       T01329                                 

Gene name
HADHA
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100469654 (HADHA)
   01212 Fatty acid metabolism
    100469654 (HADHA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100469654 (HADHA)
   00650 Butanoate metabolism
    100469654 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    100469654 (HADHA)
   00071 Fatty acid degradation
    100469654 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    100469654 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100469654 (HADHA)
   00310 Lysine degradation
    100469654 (HADHA)
   00380 Tryptophan metabolism
    100469654 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100469654 (HADHA)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100469654 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100469654 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 812 aa AA seqDB search
MAWSQRQLGTGVLVGQYIGHLAGARLRQKSPPLGSPRLSAFHFRPLQLKMVASRAIGSLS
RATASRMLRCPGYICRSFSGTSALRTRTHINYGVKGDVAVVRINSPNSKVNTLNKELQSE
FMEVMNEIWASDQIRSAVLISSKPGCFIAGADINMIASCKTPEEVTKLSQEGQRMFEKLE
KSTKPVVAAISGACLGGGLELAISCQYRIATKDRKTVLGTPEVLLGLLPGAGGTQRLPKM
VGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYLEEVAVTFAKGL
SDKKISIKRDKGLVEKLTSYAMSIPFVRQQIYKKVEEKVRKQTKGLYPAPLKIIDVVKTG
IEQGSDAGYLSESQKFGELTMTKESKALIGLYHGQVLCKKNKFGAPQKEAKHLAILGAGL
MGAGIAQVSVDKGLKTILKDATLAGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLTG
QLDYQGFEKADMVIEAVFEDLSLKHRVLTEVEAVIPDHCIFASNTSALPINEIAAVSKRP
EKVIGMHYFSPVDKMQLLEIITTEKTSKDTTASAVAVGLKQGKVIIVVKDGPGFYTTRCL
APMMSEVLRILQEGVEPKKLDALTTSFGFPVGAATLVDEVGVDVAKHVSEDLGKAFGERF
GGGSVELLKQMVSRGFLGRKSGKGFYIYQEGVKSKNVNSDMDGILASLKVPPKSDVSSDE
DIQYRLVTRFVNEAVMCLQEGILATPTEGDIGAVFGLGFPPCLGGPFRFVDLCGAQNIVD
RLRKYEAAYGTQFSPCQLLIDHASSPNKKFFQ
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggcatggagccagaggcaactcggcacaggagttttagtcgggcagtacatcggacac
ctagctggggctcggctgaggcagaaaagtcctccgctcggcagcccccgtctgagcgct
ttccactttcgtcctcttcagctcaagatggtggcctcccgggcgatcggcagtctcagc
cgcgccactgcctccaggatgctccgctgcccaggttatatttgccgcagcttttcaggg
acctctgctttgcgaaccagaacccatattaactatggagtcaaaggggatgtggctgtt
gttcgaattaactcacccaattcaaaggtaaatacactaaataaagaactgcagtcagag
ttcatggaagtaatgaatgaaatctgggctagtgatcaaatcagaagtgctgtccttatc
tcatcgaagccaggctgctttattgcaggtgctgacatcaacatgatagcctcttgcaag
acccctgaagaggtaacaaaattgtcacaggaaggacagagaatgtttgagaaactcgag
aagtccacaaagcctgttgtggctgccatcagtggcgcctgcttaggaggaggacttgag
cttgccatttcctgccaatatagaatagcaaccaaagatagaaaaacagtattaggtacc
cctgaagtcttgctgggactcttgccaggagcaggaggcacacaaaggctgcccaaaatg
gtgggtgtgcctgctgcttttgacatgatgttgactggtagaaacattcgtgcagacaga
gcaaagaaaatgggactggttgaccaattggtggaacccctgggaccaggattaaaacct
ccagaggaacggacaattgaatacttagaagaagttgcagttacttttgccaaaggacta
tctgataagaaaatctctataaagagagataagggattagtagaaaaattgacatcatat
gctatgagtattccatttgtcaggcaacagatttacaaaaaggtggaagaaaaagtacga
aaacagaccaaaggtctttatcctgcacctctgaaaataatcgatgtggtgaagactgga
attgagcaggggagcgatgctggctacctctctgaatctcagaaatttggagagcttaca
atgaccaaagaatcaaaggccttgataggactttatcatggtcaagtcctgtgtaagaaa
aataaatttggagctccacagaaggaagcaaagcacctcgccattcttggtgcggggctg
atgggagccggcattgcccaggtctctgtggataagggcctgaagaccatacttaaagat
gctacactagccgggctgggccgaggacagcagcaggtgttcaaaggattgaatgataaa
gtgaagaagaaagctctaacatcatttgaaagggactccattttcagcaacttgactggg
cagctcgattaccagggttttgaaaaggctgacatggtgattgaagctgtttttgaggac
cttagtcttaagcacagagtgctaacggaagtagaagcggtgattccggatcactgtatc
tttgccagtaacacatctgctctcccaatcaatgagattgctgctgtcagcaaaagacct
gagaaggtgatcggcatgcactacttctctcctgtggacaagatgcagctgttggagatt
atcacaaccgagaaaacatctaaggacacgaccgcttcggcggtagccgtcgggctcaag
caggggaaggtcatcatcgtggttaaggacggacctggcttctacactaccaggtgtctc
gcacccatgatgtctgaagtcctcagaatcctccaggaaggagttgagcctaagaagctg
gatgcccttaccacaagctttggctttcctgtgggtgctgccacgctggtcgatgaagtg
ggtgtggatgtagcaaaacacgtatcagaagatctgggcaaagcctttggggagcggttt
ggaggtggaagcgtagaactgctaaagcagatggtgtccaggggcttcctgggtcgcaag
tctgggaagggcttttacatctaccaggagggtgtgaagagtaagaatgtgaattctgac
atggatggtattttggcaagtctgaaggtgcccccgaagtcggacgtctcctctgacgaa
gacattcagtaccgcctggtgaccagatttgtgaacgaggccgtcatgtgcctgcaggaa
gggatcttggccacacccacagagggggacatcggcgcggtcttcgggctcggctttccc
ccatgtcttggagggcccttccgcttcgtggatctgtgtggtgctcagaacatcgtggac
cggctcaggaagtacgaggccgcctacggaacacagttcagcccgtgccagctgctcatc
gaccacgctagcagccctaacaagaagttcttccagtga

DBGET integrated database retrieval system