KEGG   Ailuropoda melanoleuca (giant panda): 100469654Help
Entry
100469654         CDS       T01329                                 

Gene name
HADHA
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00062  Fatty acid elongation
aml00071  Fatty acid degradation
aml00280  Valine, leucine and isoleucine degradation
aml00310  Lysine degradation
aml00380  Tryptophan metabolism
aml00410  beta-Alanine metabolism
aml00640  Propanoate metabolism
aml00650  Butanoate metabolism
aml01040  Biosynthesis of unsaturated fatty acids
aml01100  Metabolic pathways
aml01200  Carbon metabolism
aml01212  Fatty acid metabolism
Module
aml_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
aml_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
aml_M00085  Fatty acid biosynthesis, elongation, mitochondria
aml_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100469654 (HADHA)
   00650 Butanoate metabolism
    100469654 (HADHA)
  Lipid metabolism
   00062 Fatty acid elongation
    100469654 (HADHA)
   00071 Fatty acid degradation
    100469654 (HADHA)
   01040 Biosynthesis of unsaturated fatty acids
    100469654 (HADHA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100469654 (HADHA)
   00310 Lysine degradation
    100469654 (HADHA)
   00380 Tryptophan metabolism
    100469654 (HADHA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100469654 (HADHA)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100469654 (HADHA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100469654 (HADHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 100469654
NCBI-ProteinID: XP_002913832
Ensembl: ENSAMEG00000002313
UniProt: G1L6E2
Position
Un
AA seq 763 aa AA seqDB search
MVASRAIGSLSRATASRMLRCPGYICRSFSGTSALRTRTHINYGVKGDVAVVRINSPNSK
VNTLNKELQSEFMEVMNEIWASDQIRSAVLISSKPGCFIAGADINMIASCKTPEEVTKLS
QEGQRMFEKLEKSTKPVVAAISGACLGGGLELAISCQYRIATKDRKTVLGTPEVLLGLLP
GAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQLVEPLGPGLKPPEERTIEYL
EEVAVTFAKGLSDKKISIKRDKGLVEKLTSYAMSIPFVRQQIYKKVEEKVRKQTKGLYPA
PLKIIDVVKTGIEQGSDAGYLSESQKFGELTMTKESKALIGLYHGQVLCKKNKFGAPQKE
AKHLAILGAGLMGAGIAQVSVDKGLKTILKDATLAGLGRGQQQVFKGLNDKVKKKALTSF
ERDSIFSNLTGQLDYQGFEKADMVIEAVFEDLSLKHRVLTEVEAVIPDHCIFASNTSALP
INEIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTTASAVAVGLKQGKVIIVVK
DGPGFYTTRCLAPMMSEVLRILQEGVEPKKLDALTTSFGFPVGAATLVDEVGVDVAKHVS
EDLGKAFGERFGGGSVELLKQMVSRGFLGRKSGKGFYIYQEGVKSKNVNSDMDGILASLK
VPPKSDVSSDEDIQYRLVTRFVNEAVMCLQEGILATPTEGDIGAVFGLGFPPCLGGPFRF
VDLCGAQNIVDRLRKYEAAYGTQFSPCQLLIDHASSPNKKFFQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggtggcctcccgggcgatcggcagtctcagccgcgccactgcctccaggatgctccgc
tgcccaggttatatttgccgcagcttttcagggacctctgctttgcgaaccagaacccat
attaactatggagtcaaaggggatgtggctgttgttcgaattaactcacccaattcaaag
gtaaatacactaaataaagaactgcagtcagagttcatggaagtaatgaatgaaatctgg
gctagtgatcaaatcagaagtgctgtccttatctcatcgaagccaggctgctttattgca
ggtgctgacatcaacatgatagcctcttgcaagacccctgaagaggtaacaaaattgtca
caggaaggacagagaatgtttgagaaactcgagaagtccacaaagcctgttgtggctgcc
atcagtggcgcctgcttaggaggaggacttgagcttgccatttcctgccaatatagaata
gcaaccaaagatagaaaaacagtattaggtacccctgaagtcttgctgggactcttgcca
ggagcaggaggcacacaaaggctgcccaaaatggtgggtgtgcctgctgcttttgacatg
atgttgactggtagaaacattcgtgcagacagagcaaagaaaatgggactggttgaccaa
ttggtggaacccctgggaccaggattaaaacctccagaggaacggacaattgaatactta
gaagaagttgcagttacttttgccaaaggactatctgataagaaaatctctataaagaga
gataagggattagtagaaaaattgacatcatatgctatgagtattccatttgtcaggcaa
cagatttacaaaaaggtggaagaaaaagtacgaaaacagaccaaaggtctttatcctgca
cctctgaaaataatcgatgtggtgaagactggaattgagcaggggagcgatgctggctac
ctctctgaatctcagaaatttggagagcttacaatgaccaaagaatcaaaggccttgata
ggactttatcatggtcaagtcctgtgtaagaaaaataaatttggagctccacagaaggaa
gcaaagcacctcgccattcttggtgcggggctgatgggagccggcattgcccaggtctct
gtggataagggcctgaagaccatacttaaagatgctacactagccgggctgggccgagga
cagcagcaggtgttcaaaggattgaatgataaagtgaagaagaaagctctaacatcattt
gaaagggactccattttcagcaacttgactgggcagctcgattaccagggttttgaaaag
gctgacatggtgattgaagctgtttttgaggaccttagtcttaagcacagagtgctaacg
gaagtagaagcggtgattccggatcactgtatctttgccagtaacacatctgctctccca
atcaatgagattgctgctgtcagcaaaagacctgagaaggtgatcggcatgcactacttc
tctcctgtggacaagatgcagctgttggagattatcacaaccgagaaaacatctaaggac
acgaccgcttcggcggtagccgtcgggctcaagcaggggaaggtcatcatcgtggttaag
gacggacctggcttctacactaccaggtgtctcgcacccatgatgtctgaagtcctcaga
atcctccaggaaggagttgagcctaagaagctggatgcccttaccacaagctttggcttt
cctgtgggtgctgccacgctggtcgatgaagtgggtgtggatgtagcaaaacacgtatca
gaagatctgggcaaagcctttggggagcggtttggaggtggaagcgtagaactgctaaag
cagatggtgtccaggggcttcctgggtcgcaagtctgggaagggcttttacatctaccag
gagggtgtgaagagtaagaatgtgaattctgacatggatggtattttggcaagtctgaag
gtgcccccgaagtcggacgtctcctctgacgaagacattcagtaccgcctggtgaccaga
tttgtgaacgaggccgtcatgtgcctgcaggaagggatcttggccacacccacagagggg
gacatcggcgcggtcttcgggctcggctttcccccatgtcttggagggcccttccgcttc
gtggatctgtgtggtgctcagaacatcgtggaccggctcaggaagtacgaggccgcctac
ggaacacagttcagcccgtgccagctgctcatcgaccacgctagcagccctaacaagaag
ttcttccagtga

DBGET integrated database retrieval system