KEGG   Ailuropoda melanoleuca (giant panda): 100469656Help
Entry
100469656         CDS       T01329                                 

Gene name
USP25
Definition
(RefSeq) ubiquitin specific peptidase 25
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100469656 (USP25)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100469656 (USP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1122 aa AA seqDB search
TVEQNVLQQSAAQKHQQTFLNQLREITGINDAQILQQALQDSNGNLELAVAFLTAKNAKT
PQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRETG
ITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWFS
AVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYVD
PSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFYG
RFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQEH
WFTKLPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIKR
LKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSGS
TPQTLPSATEQQGAPSSELPSTSPASIAAVSSRSVVHKPFTQSRIPPDLPMHPAPRHITE
EELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHEGQ
ANAGHYWAYIFDHRENRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKAQFL
IKEELNKETGQALVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQKL
RESESSVTTAQAGEPEYLEQPSRSDFSKHLKEETIRIITKASHEHEDKSPETVLQSKPEN
TTSQPPSNQQVVEVAIPHVGKFMIESKEGGYDDEIMMTPNMQGIIMAIGKSRNVYDRCGP
EAGFFKAIKLEYSRLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLLEQFGDRN
LSFDERCHNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQKESY
IDSLLFLICAYQNNKELLSKGPNRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNN
GLIIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMESNLQEKLTDFLPKLL
DCSTEIKGFHEPPKLPSYSTHELCERFARIMLSLSRTPADGR
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
accgtggagcagaatgtgctgcagcagagcgcagcgcagaagcaccagcagacgtttttg
aatcagctgagagaaatcactgggattaatgatgcccagatactccagcaagccttacag
gatagtaatggaaacttggaattagctgtggctttccttactgcaaagaatgccaagacc
cctcagcaggaggagacaacttactaccaaacagcacttcctggcaatgatagatacatc
agtgtgggaagccaagcggacacaaatgtgattgatctcactggagatgataaagatgat
cttcagagagcaattgccttgagtttggcggaatcaaacagggcattcagggagactgga
ataactgatgaggagcaagccattagcagagttcttgaagccagcatagcagaaaataaa
gcatgtttaaagagaacacctacagaagtttggagggattctcgaaacccttacgataga
aaaaggcaggacaaagctcctgttggactgaagaatgttggcaatacttgctggtttagt
gctgttattcagtcattattcaatcttttggagtttagaagattagttctgaattacaag
cctccgtcaaatgctcaagatttaccccgaaaccaaaaggagcatcggaatttgcctttt
atgcgtgagctaaggtatctatttgcacttcttgttggtactaaaaggaaatatgttgat
ccatcaagagccgttgaaattcttaaggacgctttcaaatcaaatgactcccagcagcaa
gatgtgagtgagtttacacacaaattattagattggttagaagatgccttccaaatgaaa
gctgaagaagagacggatgaagagaagccaaagaaccccatggtagagttgttctatgga
agattccttgctgtgggagtacttgaaggtaaaaaatttgaaaatactgaaatgtttggt
cagtacccgcttcaggtcaatggattcaaagatctacatgagtgcctagaagctgctatg
attgaaggagaaattgagtccttacattcagagaattcaggaaaatcaggccaagagcat
tggttcaccaaactaccacctgtgttaacatttgaattgtcaagatttgaattcaatcag
gcattgggaagaccagaaaaaattcacaacaaattagaatttcctcaagtgttatatctg
gacagatatatgcacagaaacagagaaataacaagaattaagagggaagaaatcaagaga
ctaaaagattacctcacagtattacaacaaagactagaaagatatttaagctacggttcg
ggtcccaaacgattccccttggtagatgttctacagtacgcgttggaatttgcttcaagt
aaacctgtttgtacatctcctgttgatgatattgatgctagttccccacctagtggttcc
acaccacagacattaccaagcgcaacagaacaacagggagccccttcttcagaactgcca
agcacatcccctgcctccatagctgccgtgtcatcgagatcagtagtacataaaccattc
actcagtctcggatacctccagatttgcccatgcatccagccccaaggcacataacagaa
gaagaactttctgtgctagaaagctgtttacatcgctggaggacagaaatagaaaatgat
accagagatttgcaggaaagcatatccagaatccatcgaacaattgaactaatgtactct
gacaaatctatgatccaggttccttatcgcttacatgctgttttagttcacgaaggccaa
gctaatgccgggcactactgggcatatatttttgatcatcgtgaaaacaggtggatgaag
tacaatgatattgcagtgacaaagtcatcatgggaagagctagtgagggactcttttggt
ggttatagaaatgccagtgcatactgtttaatgtacataaatgataaggcacaattctta
ataaaagaggagttaaataaagaaactgggcaggctcttgttggaatagaaacattacca
ccggatttaagagattttgttgaggaagacaaccagcgatttgaaaaagaactagaagaa
tgggatgcgcaactcgcccagaaggctttgcaggaaaaacttctagcatctcagaaattg
agggagtcagaatcttctgtaacaacagcacaagcaggagaaccagaatatctagagcag
ccatcaagaagtgatttctcaaagcacttgaaagaagaaactattcgaataattaccaag
gcatcacatgagcatgaagataaaagtcctgaaacagttttgcagtcgaaacctgaaaat
accacaagccaaccaccttctaaccagcaagttgtagaggtggcgattcctcatgtaggg
aaattcatgattgagtcaaaggaggggggttatgatgacgagatcatgatgacaccgaac
atgcaaggtattatcatggcgataggtaaatccaggaatgtatatgacaggtgtggccct
gaagcagggttctttaaggcaattaagttggagtattcaagattggttaaattggcccaa
gaagataccccaccagaaacagattatcgtttacatcatgtagtggtctattttatccag
aaccaagcgccaaagaaaatcattgagaaaacattgctagaacaatttggagatagaaat
ttgagttttgatgaaaggtgtcacaacataatgaaagttgctcaagccaaacttgaaatg
atcaaacctgaagaagtaaacttggaggaatatgaggagtggcatcaggattataggaaa
ttcagggaaacaaccatgtatctcataattgggctagaaaattttcaaaaagaaagttat
atagattccctgttgttccttatctgtgcgtatcagaataacaaggaactcttgtccaaa
ggtccaaaccgaggacatgatgaagaattgatatcacattatagaagagaatgtttacta
aaattaaatgagcaagcagcagaactgtttgaatctggagaggatcgagaagtaaacaat
ggtctgattatcatgaacgagtttattgtcccgtttttgcccttgttattggtggatgaa
atggaagagaaggatatacttgccgtggaagacatgagaaatcgatggtgttcctatctc
ggacaagaaatggaatcaaacctccaagagaagctgacagattttctgccaaaactgctt
gattgttctactgagattaaagggttccatgagccaccgaagttaccttcgtattccacc
catgaactgtgtgagcggtttgcccgaatcatgttgtccctcagtcgaactcctgctgat
ggaagataa

DBGET integrated database retrieval system