KEGG   Ailuropoda melanoleuca (giant panda): 100469705Help
Entry
100469705         CDS       T01329                                 

Definition
delta-1-pyrroline-5-carboxylate synthase-like
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aml01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aml00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 793 aa AA seqDB search
MLSQVYCSRFQPFRQRLLPWVQFSALSRSHRIQASAIRHVRSWSNIPFITVPLSRAHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVIS
VKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKSR
VGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPT
VEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPL
LKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFES
RPDCLPQVAALAIASGNGLLLKGGKEATHSNRILHLLAQEALSIHGVKEAIQLVNTREEV
EDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVR
DSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVK
SLRTEYGDLELCIEVVDSVQEAIDHIHKYGSSHTDVIITENEKTAEFFLQHVDSACVFWN
ASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSLKY
LHENLPVPQRNTN
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtcaagtctactgctccaggttccagcccttccgccagcgtctcctgccctgg
gtccaattctcagccctctccagatctcatcgtatccaggcttcagccatcagacatgtt
cgttcttggagcaatatcccctttatcactgtacccctcagtcgtgcacacggcaagtct
ttcgcccaccgcagtgagctgaagcatgccaagagaatcgtggtgaagctcggaagtgct
gtagtaacgcgtggggatgagtgtggccttgccctggggcgcctggcatctattgttgag
caggtgtcagtgctacagaaccaaggccgagagatgatgctggtgaccagtggagctgta
gcctttggcaagcaacgcttgcgccatgagatccttctgtctcagagcgtccggcaggcc
ctgcactcgggtcagaaccagctgaaagagatggcaattccagtcttagaagcacgagcc
tgcgcagccgccggacagagtggactgatggccttgtatgaggccatgtttacccagtac
agcatctgtgctgcccagatcttggtgaccaacttggatttccacgatgagcagaagcgc
cggaaccttaatgggacactgcatgaactcctccgaatgaacatcgtccccattgtcaac
acaaatgatgctgtcgtacccccagctgagcccaatagtgatctccagggggttattagt
gttaaagataatgatagcctggctgcgcgtctggccgtggaaatgaaaactgacctcctg
attgttctttcagatgtagaaggtctctttgacagtcccccagggtcagatgatgcaaag
ctcattgatatattttatcctggagatcagcagtctgtgacttttggaaccaagtcaaga
gtgggaatgggtggcatggaagccaaggtgaaagcggccctctgggctttgcaaggtggc
acttctgtggttattgccaacggaacccacccaaaggtgtctgggcatgtcatcacagac
atcgtggagggaaagaaagttggcaccttcttttccgaagtaaagcctgcaggtcctacc
gttgagcagcagggagaaatggctcgatcaggaggaaggatgttggccactttggaacct
gagcagagagcagagattatccatcatctggctgatctattgacagaccaacgtgatgag
atcctgttagccaacaaaaaagacttggaggaggcagagggaagactcgcagctcccctg
ctgaaacgcctgagcctctccacatccaaattgaatagcctggccattggtctgcgacaa
attgcagcctcctcacaggatagcgtggggcgtgttttgcgccgaacacgaattgccaaa
aatttggaactagaacaagtgactgtcccaattggagtcctgctggtcatctttgagtcc
cgccctgactgtctgccccaggtggcagccttggctattgcgagtggtaatggcttgtta
ctcaaaggagggaaggaggccacacacagcaatcggattcttcaccttttggcccaagag
gccctctcaatccatggagtcaaagaggccatacagctggtgaataccagagaagaagtg
gaagatctttgtcgcctggacaaaatgatagatctgatcattccacggggctcttcccag
ctggtcagagatatccagaaagctgctaagggaatcccggtgatggggcacagtgagggg
atctgccacatgtatgtggattcagaggccagcgtcgataaagtcaccagactggtccga
gactctaaatgtgaatatccagctgcctgtaatgctttggagactctgttaatccacaga
gatctgctgagaacaccgttatttgaccagatcattgacatgctgagagtggaacaggtg
aaaattcacgcaggccccaagtttgcctcctacctgaccttcagcccctctgaagtaaag
tccctccgaacggagtatggggacctggaattgtgcattgaagtggtggacagcgtccag
gaggccatcgaccacatccacaagtatggcagctcgcacacagatgtcatcatcacagag
aatgagaaaacagcagagttctttctccagcacgtagatagtgcctgtgtgttctggaat
gccagcactcgtttctctgatggctaccgctttggactgggagccgaagtgggcatcagc
acatcgaggatccacgcgcggggaccggtaggacttgagggactgctcactactaaatgg
ctgctgcgagggcaggaccacgtggtctcagatttctcagagcatggaagtttaaaatac
cttcacgagaacctccctgtgcctcagagaaacaccaactga

DBGET integrated database retrieval system