KEGG   Ailuropoda melanoleuca (giant panda): 100469737Help
Entry
100469737         CDS       T01329                                 

Definition
ras-related C3 botulinum toxin substrate 2-like
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Choline metabolism in cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100469737
   04015 Rap1 signaling pathway
    100469737
   04010 MAPK signaling pathway
    100469737
   04310 Wnt signaling pathway
    100469737
   04370 VEGF signaling pathway
    100469737
   04024 cAMP signaling pathway
    100469737
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100469737
  Cellular commiunity
   04510 Focal adhesion
    100469737
   04520 Adherens junction
    100469737
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100469737
   04662 B cell receptor signaling pathway
    100469737
   04664 Fc epsilon RI signaling pathway
    100469737
   04666 Fc gamma R-mediated phagocytosis
    100469737
   04670 Leukocyte transendothelial migration
    100469737
   04062 Chemokine signaling pathway
    100469737
  Development
   04360 Axon guidance
    100469737
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100469737
   05231 Choline metabolism in cancer
    100469737
   05210 Colorectal cancer
    100469737
   05212 Pancreatic cancer
    100469737
  Cardiovascular diseases
   05416 Viral myocarditis
    100469737
GTP-binding proteins [BR:aml04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100469737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIERLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRPQKRPCSIL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagatggagccgtgggcaaaacgtgccttctt
atcagctacaccaccaacgctttcccaggagagtacatccccactgtgttcgacaactat
tcagccaatgtgatggtggacagcaagcccgtgaacctggggctgtgggacacggcgggg
caggaggactatgaccgcttgcggccgctctcctacccacagacggacgtcttcctcatc
tgcttctcccttgtcagccctgcgtcctatgagaatgtccgtgccaagtggttccccgag
gtgcggcaccactgccccagcacacccatcatcctggtgggcaccaagctggatctgcgg
gacgacaaggacaccatcgagaggctgaaggagaagaaactggcgcccattacctacccg
cagggcctggcactggccaaggagatcgactcggtaaaatacctggagtgctcggccctc
acccagcgaggcctgaagactgtctttgatgaggcaatccgggctgtcctgtgcccccag
cccacgcggccacagaagcgtccctgcagcatcctgtag

DBGET integrated database retrieval system