KEGG   Ailuropoda melanoleuca (giant panda): 100469748Help
Entry
100469748         CDS       T01329                                 

Gene name
ATP7B
Definition
(RefSeq) ATPase copper transporting beta
  KO
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Drug resistance
   01524 Platinum drug resistance
    100469748 (ATP7B)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     100469748 (ATP7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1529 aa AA seqDB search
MVGKGVTVDPAMEEAGSETPGSPEPSFLATLGDPQVTLVSVHKRWSFRRNPGARGSTRPV
TSEEEEEFAQKVLNGARGIRSNQILSKLSLPTRAWEPEMKQSFAFDNVGYEGGLDGACPP
QTTSTVSVSGMTCQSCVQSIEGRISSLKGVVSIKVSLEQGSATVTYVPSILSLPQICHHI
EDMGFEASVAEGKAASWPSRSSSGLEAVVKLRVEGMTCQSCVSSIEGKLGKLQGVVRVRV
SLGTQEAVITYQPYLIQPQDLRDHVNDMGFEAVIKNRVAPVSLGPIDIGRLQRTNPKTPL
ASDNQNLNNSETSGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLPGVQSIQVSLENRM
AQVQYDPSRVTAGALQRAIEALPPGNFKVSLPDGAEGSGTGSWSSNRVTPAPDPRTQAPG
VYETVVLAIAGMTCASCVQSIEGLISQREGVQQMSVSLAEGTGVVLYDPAIINPEELRAA
VEEMGFETSVISGNCYSNHVGNHSAGNSSACPAAGVPASVQEVAPHAGGLPKSHDPGSSS
KPPQASTLGAPQKCFLQITGMTCASCVSNIERNLQKEAGILSVLVALMAGKAEVKYNPEV
IQPLEVARLIQDLGFEATVMEDYTGTDGDLELIIMGMTCASCVHNIESKLTRTNGITYAS
VALATSKAHVKFDPEIIGPRDIVRIIEEIGFHASPAQRNADAHHLDHKVEIKQWKKSFLC
SLVFGIPVMGLMIYMLVPSNEPHESMVLDHNIIPGLSILNLIFFILCTFVQLLGGWYFYV
QAYRSLRHRAANMDVLIVLATSIAYSYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIAL
GRWLEHVAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIIKVVPG
GKFPVDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLINATHVGNDTTL
AQIVKLVEEAQMSKAPIQQLADRFSGYFVPFIIIISTLTLVVWIIIGFIDFGVVQKYFPT
PNKHISQAEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLE
MAHKIKTVMFDKTGTITYGVPKVMRVLLLVDVATMPLRKVLAVVGTAEASSEHPLGVAVT
KYCKEELGTETLGYCTDFQAVPGCGIGCKVSSVEGILAHSEHPQSKQAAPPNTVGGIPEE
IDATPQTFSVLIGNREWMRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCAMFAIAD
AVKQEAALAVHTLKSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQ
NEGKKVAMVGDGVNDSPALARADVGIAIGTGTDVAIEAADVVLIRNDLLDVAASIHLSKR
TVWRIRLNLVLALIYNLIGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCY
KKPDLERYEAQAQGRMKPLTASQVSVHIGMDDRRRDSPRATPWDQVSFISQVSLSSLKSD
KLSRHSATAEDNGDKWSLLLNDRDEEQCI
NT seq 4590 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtaaaggtgtgaccgtggacccagcgatggaggaggctgggagtgagacgccg
gggagccctgagccgtccttcctggcgaccctgggtgacccacaggtgaccctggtgtcc
gtccacaagcggtggtccttcaggaggaaccctggggccaggggctccaccaggccagtg
acttcggaggaggaggaagagtttgcacagaaggttctgaatggagcacgaggaatccgt
tccaatcagatcctgtctaaactttctttgcccactcgtgcctgggagccagagatgaag
cagagtttcgctttcgacaatgttggctacgagggcggcctggacggtgcgtgcccccct
cagacgaccagcaccgtcagcgtttcgggcatgacttgccagtcatgtgtacagtctatc
gagggcaggatttccagtttgaaaggcgtcgtgagcattaaggtttccctggaacagggc
agtgcgactgtgacgtacgtgccgtccatcctgagcctgccgcagatttgccatcacatt
gaggacatgggcttcgaggccagcgtcgcagaaggaaaggccgcctcctggccctcgagg
tcttcgtctggcctcgaggccgtggtcaagcttcgggtggagggcatgacctgccagtcc
tgcgtcagctccatcgaaggcaagcttgggaaactgcaaggtgtagtgagagtccgagtg
tccctcggcacccaggaggcagtcattacttaccagccttatcttattcagccccaggac
ctcagggaccatgtcaacgacatgggctttgaagctgtcatcaagaacagagtggcgccc
gtcagcctgggacccattgatattgggcggttacagaggaccaacccaaagacacctttg
gcttctgataaccagaatctcaataactctgagacctcagggcaccaagggagccatgtg
gtcaccctgcaactgagaatagatggaatgcactgtaagtcttgtgtcctgaatattgaa
gaaaacataggccaactccctggggttcaaagtattcaagtttccttggagaacagaatg
gcccaagtacagtatgacccttctcgtgtcaccgcaggggccctgcagagggccattgaa
gctcttccacctgggaactttaaagtttctcttcctgatggagcagaggggagtgggaca
ggtagctggtcttccaaccgtgtcacccctgcccccgacccgagaacccaggcaccaggc
gtgtatgaaaccgtggtgctcgccattgctggcatgacctgtgcgtcctgtgtccagtcc
attgaaggcctgatctcccaaagggaaggggtgcaacaaatgtcagtctctctggccgaa
gggactggagtggtgctctatgatcccgccataattaacccagaagaactccgagctgct
gttgaagaaatgggatttgagacttcagtcatttctggaaactgttacagcaaccatgtt
ggaaaccacagtgcggggaattcctcagcgtgccccgcagctggcgtacctgcgtctgtg
caggaagtggctccccatgctggggggctccctaaaagccacgaccctggctcctcgtca
aagcccccgcaagcctctaccctgggggcaccccagaagtgctttttacagatcacaggc
atgacctgtgcgtcctgtgtgtccaacatagagagaaacctgcagaaagaagcagggatt
ctctcggtgctggttgccctgatggcgggaaaggcagaggttaagtataacccagaagtc
atccagccgctggaggtagcgcggctcatccaggacctgggctttgaggcgacagtaatg
gaagactacacaggcacagacggcgacctcgagctgattatcatggggatgacgtgcgca
tcctgtgttcacaacatagaatccaaactcacaaggacaaacggcatcacctacgcctct
gtggctcttgccaccagcaaagcccacgtgaagtttgatcctgaaattattggtccacgg
gatattgtcagaattatcgaggaaattggctttcatgcttccccggcccagagaaacgcc
gatgcgcatcacttggaccacaaggtggaaataaagcagtggaagaagtcttttctgtgc
agcctggtgttcggcatccccgtcatgggtctgatgatctatatgttggtgcccagcaac
gagccccacgagtctatggtcctggaccacaacatcattccaggactgtccatcctaaac
ctcatcttctttatcttgtgtacctttgtccagctccttggcgggtggtacttctacgtc
caggcctacagatctctgaggcacagggcggccaacatggacgtgctcatcgtgctggcc
accagcatcgcctacagctactcgctcgtcatcctggtggtggccgtagccgagaaggcg
gagaggagccccgtgaccttcttcgacacccctcccatgctctttgtgttcattgccctg
gggcggtggctggaacacgtggcaaagagcaaaacctcagaagcccttgccaaactcatg
tctctccaagccacagaagccaccgttgtgacccttggcgaggacaacttgatcatcaga
gaggagcaggtacccatggagctggtgcagcggggcgatatcatcaaggttgtccccggg
ggaaagttcccagtggatgggaaagtcctggaaggcaacaccatggccgacgagtccctc
atcacaggggaagccatgccggtcacgaagaaaccgggaagcacagtgatcgcagggtct
ataaatgcacatggctctgtgctcattaatgccacccatgtgggcaatgacaccacgttg
gctcagattgtgaaattggtggaagaggctcagatgtcaaaggcacccattcagcaactg
gctgaccggtttagtggatattttgtcccatttatcatcatcatttcaacgttgacgttg
gtggtatggattataatcggttttatcgattttggtgttgttcagaaatactttcctacc
cccaacaagcatatctcccaggcagaggtgatcatccggttcgcgttccagacctccatc
accgtgctatgcatcgcctgcccctgctctctgggcctggccacgcccacggccgtcatg
gtgggcaccggggtggccgcccagaatggcatcctcatcaaaggaggcaagcctctggag
atggcccacaagataaagaccgtgatgtttgacaaaactggcaccattacctacggggtc
cccaaagtcatgcgggtcctcctgctcgtggatgtggccacaatgcccctcaggaaggtt
cttgctgtagtggggactgcggaggcgagcagtgagcaccccctgggcgtggcagtcacc
aagtactgtaaagaggaattgggaaccgagaccttgggctactgcacggacttccaggca
gtgccgggctgtggcatcggctgcaaagtcagtagcgtggagggcatcctggcccacagc
gagcaccctcagagcaaacaggctgctcccccaaacacggttggcggcattcccgaggaa
atagatgcgaccccccagaccttctctgtgctgattgggaaccgtgaatggatgagacgc
aacgggctaaccatttccagcgacatcagtgacgcgatgacggatcacgagatgaaaggc
cagacggccatcctggtggccattgacggtgtgctctgcgccatgttcgccatcgcggac
gcagtcaagcaggaggcagcgctggccgtgcacacgctgaagagcatgggtgtggacgtg
gttctgatcacaggcgacaaccggaagacggccagagccattgccacccaggtgggcatc
aacaaagtcttcgcagaggtgctgccttctcacaaggtggccaaggtccaggagctccag
aatgaagggaagaaagtcgccatggtgggagatggggttaacgactcgccggccttggcc
cgggccgatgtgggcattgccatcgggacaggcacagatgtcgccattgaggctgctgac
gttgtcctcatcagaaacgacttgctcgatgtggcggctagcatccacctctccaagagg
accgtctggaggatacgcctcaacctggtcctggcactgatctataacctgattggaata
cccattgccgcaggggtcttcatgcccatcggcatcgtgctgcagccgtggatgggctcg
gcagccatggcggcctcctccgtgtctgtggttctctcatcgctgcagctcaagtgctac
aagaagcccgacctggagaggtatgaggcccaggcccagggccgcatgaagcccctgacg
gcgtcgcaggtgagcgtgcacatcggcatggatgaccggcgacgagactccccgagggcc
acaccctgggaccaggtcagcttcatcagccaggtgtctctgtcctccctgaagtctgac
aagctgtctcgacacagtgccacggctgaggacaatggggacaagtggtctctgctcctg
aatgaccgagatgaggagcagtgcatctga

DBGET integrated database retrieval system