KEGG   Ailuropoda melanoleuca (giant panda): 100469942Help
Entry
100469942         CDS       T01329                                 

Gene name
MAP3K12
Definition
mitogen-activated protein kinase kinase kinase 12
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:aml04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 859 aa AA seqDB search
MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTHVLQLHEQDAGGPGG
ASGSPESRASRVRADEVRLQCQSGSGFLEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEV
PFEEILDLQWVGSGAQGAVFLGRFHGEEVAVKKVRDLKETDIKHLRKLKHPNIITFKGVC
TQAPCYCILMEFCAQGQLYEVLRAGRPVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSP
NMLITYDDVVKISDFGTSKELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVL
WELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSGCPDGFKILLRQCWNSKPRNRPSFRQI
LLHLDIASADVLSTPQETYFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELVMRRREELR
HALDIREHYERKLERANNLYMELNALMLQLELKERELLRREQALERRCPGLLKSHPSRGL
LHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRS
RRGKTRHRKASAKGSCGDLPGLRAALPPHEPGGPGSPGGLGGGPSGWEACPPALRGLHHD
LLLRKMSSSSPDLLSAALGARGRGATGGAGDPGSPPPARGDTPPSEGSAPGSTSPDSPGG
AKGEPPPPVGPGDVVGLLGTGREGTAGRGGSRAGSQHLTPAAMLYRAAVTRSQKRGISSE
EEEGEVDSEVELPSSQRWPQGLNMRQSLSTFSSENPSDGEEGTASEPSPSGTPEVGSTNT
DERPDERSDDMCSQGSEIPLDPPASEVVPGPEPSSRPIPHQDLPREGQGPPSEDSDCDST
ELDNSNSGEALQPPASLPP
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctccacgagacccgcacaccctccccttccttcgggggcttcgtgtccacc
ctcagcgaggcgtccatgcgcaagctcgacccggacacttccgactgcaccccggagaag
gacctgacgcccacccatgtcctgcagctccacgagcaggatgcagggggccccggggga
gcctctgggtcccctgagagtcgggcgtcccgagttcgggccgatgaggtgcggctgcag
tgccagagcggcagcggcttcctggaagggctcttcggctgcctgcgccccgtctggacc
atgatcggcaaggcctactccacggagcacaagcagcagcaggaagacctttgggaggtc
ccctttgaggagatcctggacctgcagtgggtgggctcaggggcccagggcgctgtcttc
ctggggcgcttccacggggaggaggtggctgtgaagaaggtacgggacctgaaggagacg
gacatcaagcacctgcgaaagctgaagcaccccaacatcatcaccttcaagggcgtgtgc
acccaggctccctgctactgcatcctgatggagttctgcgcccagggccagctgtatgag
gtactgcgggccggccgccctgtcaccccttccttgctggttgactggtccatgggcatc
gccggtggcatgaactacctgcacctgcacaagattatccatagagacctcaagtccccc
aacatgctaatcacgtacgacgatgtggtgaagatctccgattttggcacttccaaggag
ctgagtgacaagagcaccaagatgtcctttgcagggacagtagcctggatggctcctgaa
gtgatccgcaacgagcccgtgtccgagaaggtcgacatctggtcctttggcgtggtgctg
tgggaactgctgactggtgagatcccctacaaagatgtggactcctcagccatcatctgg
ggtgtggggagcaacagtctccatctgcctgtgccctccggctgccccgacggcttcaaa
atcctgcttcgccagtgctggaacagcaaaccaagaaatcgtccctcattccgccagatc
ctgctgcacctggacatcgcctcggctgacgtcctctccacgccccaggagacttacttt
aagtcccaggcagagtggcgcgaagaggtaaagctgcactttgaaaaaattaagtcagaa
gggacttgtctgcaccgcctagaagaggagctggtgatgcggcggagggaagagctcaga
cacgccctggacatcagggagcactacgaacggaagctggagcgggccaacaacctgtac
atggagctcaacgcgctcatgctgcagctcgagctcaaggagcgggagctgctcaggagg
gaacaagctttggagcggagatgcccaggtctgctgaagtcacacccttcccgaggcctc
ctgcatgggaacacgatggagaagctcatcaagaagaggaacgtcccacagaaactgtca
ccccacagtaaaaggccggatatcctcaagactgaatctttgctgcctaaacttgatgct
gccctgagtggggtggggcttcccgggtgtcctaagggccccccctcaccaggacggagt
cgtcgtggcaagactcgtcaccgcaaggccagcgccaagggcagctgtggagacctgcct
gggcttcgtgcagctttgccaccccatgaacctgggggaccaggaagcccaggggggcta
ggagggggaccctcaggctgggaggcctgccctccagccctgcgtgggctccatcatgac
ctcctgctccgaaaaatgtcgtcgtcgtccccagatctgctgtcagcagcactgggagcc
cggggccgaggggccacagggggagctggggatcctggctcaccgcctccagcccgggga
gacaccccgccaagtgagggctcagcacctggctccaccagcccagattcacctggggga
gccaaaggggagccacctccaccagtagggcctggtgacgttgtggggctactgggaact
ggaagggaagggacggcgggacggggaggaagccgggctgggtcccagcacttgacccca
gctgcaatgctgtacagggctgctgtcacccggagccagaaacgtggcatctcgtcagag
gaagaggaaggcgaggtggacagtgaagtggagctgccctcgagccagaggtggcctcag
ggcctgaacatgcgccagtcactgtccaccttcagctccgagaacccatctgacggggag
gagggcacagccagcgagccctcccccagtggcacacctgaagttggcagtaccaacacc
gacgaacggccagacgagcggtctgatgacatgtgttcccagggctcagaaatcccactg
gacccgcctgcgtcggaggtggttcctggccccgaacccagctcccgacccatcccacac
caggacctacccagagaggggcagggccctcccagtgaggactcagactgtgacagcacc
gaactggacaactccaacagtggtgaagccttgcagcctccagcctccctccctccatga

DBGET integrated database retrieval system