KEGG   Ailuropoda melanoleuca (giant panda): 100470035Help
Entry
100470035         CDS       T01329                                 

Definition
mitogen-activated protein kinase 1-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Aldosterone-regulated sodium reabsorption
Alzheimer's disease
Prion diseases
Alcoholism
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:aml04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:aml04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:aml04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:aml04012]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:aml04350]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:aml04370]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:aml04668]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:aml04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aml04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aml04150]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:aml04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:aml04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:aml04510]
Cellular Processes; Cell communication; Adherens junction [PATH:aml04520]
Cellular Processes; Cell communication; Gap junction [PATH:aml04540]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:aml04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:aml04621]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:aml04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:aml04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:aml04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:aml04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:aml04666]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:aml04062]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:aml04910]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:aml04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:aml04915]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:aml04914]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:aml04917]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:aml04921]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:aml04919]
Organismal Systems; Endocrine system; Melanogenesis [PATH:aml04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:aml04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:aml04270]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:aml04960]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:aml04724]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:aml04725]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:aml04726]
Organismal Systems; Nervous system; Long-term potentiation [PATH:aml04720]
Organismal Systems; Nervous system; Long-term depression [PATH:aml04730]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:aml04723]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:aml04722]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:aml04320]
Organismal Systems; Development; Axon guidance [PATH:aml04360]
Organismal Systems; Development; Osteoclast differentiation [PATH:aml04380]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:aml04713]
Human Diseases; Cancers; Pathways in cancer [PATH:aml05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:aml05205]
Human Diseases; Cancers; Viral carcinogenesis [PATH:aml05203]
Human Diseases; Cancers; Colorectal cancer [PATH:aml05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:aml05212]
Human Diseases; Cancers; Glioma [PATH:aml05214]
Human Diseases; Cancers; Thyroid cancer [PATH:aml05216]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:aml05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:aml05220]
Human Diseases; Cancers; Melanoma [PATH:aml05218]
Human Diseases; Cancers; Renal cell carcinoma [PATH:aml05211]
Human Diseases; Cancers; Bladder cancer [PATH:aml05219]
Human Diseases; Cancers; Prostate cancer [PATH:aml05215]
Human Diseases; Cancers; Endometrial cancer [PATH:aml05213]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:aml05223]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:aml05010]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:aml05020]
Human Diseases; Substance dependence; Alcoholism [PATH:aml05034]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:aml04930]
Human Diseases; Infectious diseases; Salmonella infection [PATH:aml05132]
Human Diseases; Infectious diseases; Pertussis [PATH:aml05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:aml05152]
Human Diseases; Infectious diseases; Influenza A [PATH:aml05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:aml05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:aml05160]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:aml05145]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:aml05140]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:aml05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 523 aa AA seqDB search
MTREVEQLFSQAHWVGAGPEATGAGPQPDQRCRAHAWGSWALHVRPRADPGAMDISKCIL
DVQHRFLIGSPLAAAGRTPLCRCVWLVLACQADFPEREERPRWEGGSTRNLVCGGPSRPQ
PPRSPPSPHTSREGKPKRGSPRRPVLFAEAPQLCQMRRALPFMRHASLAKGLSVHVSAGL
LGGVFSAGGVLSRDGMAVSPVCSSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLR
FRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGL
KYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPE
IMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIIN
LKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYY
DPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggaagtggagcagctcttctcccaggcccactgggtaggggcaggaccagag
gccacaggcgcaggcccgcagccagaccaaagatgccgggcacacgcatggggcagctgg
gcgctgcatgtgaggccccgggcagacccaggggcgatggacatttccaagtgtatcctg
gatgtccagcacaggtttctcattggctcccccctggccgcagctgggaggactcctctc
tgtagatgcgtctggctggtcctggcctgccaagccgacttcccagagcgggaagagcgg
ccccgttgggaaggagggagcaccaggaatctggtctgcggtgggccctcgcggccccag
cctccccggtcccctcccagcccgcacacatccagggaggggaagcccaagagaggcagc
cccaggaggcctgtgcttttcgccgaggctccgcagctttgccaaatgcgccgagctttg
ccattcatgcgccatgccagccttgccaagggtttatctgtgcacgtctcggcagggctc
ctgggaggggtgttctctgcagggggcgtcttgtcccgagatgggatggctgtctcccct
gtctgcagctctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagt
ccttttgagcaccagacctactgccagagaactctgagggagataaaaatcttactgcgc
ttcagacatgagaacatcattggaatcaatgatattattcgagcaccaaccatcgagcaa
atgaaagatgtatatatagtacaggacctcatggaaacagatctatacaagctcttgaag
acgcaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggtta
aaatatatccattcagccaatgtactgcaccgtgacctcaaaccttccaacctgctgctc
aataccacctgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccggac
cacgatcacacagggttcctgacggagtatgtagccacacgctggtacagggctccggaa
attatgttgaattccaagggctataccaagtccattgatatttggtctgtaggctgcatt
ctggcagagatgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctg
aaccacattctgggtattcttggatccccatcacaggaagacctgaactgtataataaat
ttaaaagctagaaactacttgctttctcttccacacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgactccaaagctctggatttactggacaagatgttgacattcaac
cctcacaagaggattgaagtagagcaggctctggcccatccatatctggagcagtattac
gacccaagcgatgagcccatcgctgaggcgccattcaagtttgacatggagctggatgac
ctgcccaaggaaaagctcaaagaactcatcttcgaagagacagctagattccagccggga
tacagatcttaa

DBGET integrated database retrieval system