KEGG   Ailuropoda melanoleuca (giant panda): 100470037Help
Entry
100470037         CDS       T01329                                 

Definition
Na(+)/H(+) exchange regulatory cofactor NHE-RF2-like
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100470037
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 312 aa AA seqDB search
MGNCLGWLCLTPRDQTNCLTQLPGPYRAEASPCSDSAALEALCQESWVVQRIKAVEGQTR
LLVVDKETDEELRRRQLTCTEEMAHRGLPPTHDPWEPKPDWARASSLGSEAGQKDVGGAP
RELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAAHSGLHAQDRLIEVNGQNV
EGLRHAEVVASIKAREDEARLLVVDPETDEYFKRLRVTPTEEHVEGPLPSPVTNGTSPAQ
INGGSACSSRSDLPGLDKDTEDSTWKRDPFQESGLHLSPTAAEAKEKARATRVNKRAPQM
DWNRKREIFSNF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgtctgggctggctgtgcctgacccccagggaccagaccaactgtctcacc
cagcttcccggcccctaccgggccgaggcaagcccctgcagcgactctgcagccctcgaa
gccctgtgtcaggagtcctgggtggtgcagaggatcaaggctgtggaagggcagactcgg
ctgctggtggtggacaaagagacggacgaggagctccgccggcggcagctgacctgcact
gaggagatggcccatcgagggcttccgcccacccacgacccctgggagccaaagccggac
tgggcacgtgcaagcagcctgggctccgaggctggccagaaggatgtcggtggggccccg
agggagctacgccctcggctctgccacctacgaaagggcccccaaggctatgggttcaac
ctgcacagtgacaagtccaggcccggacagtatatccgctcggtggacccaggctcgcct
gctgctcactctggcctccacgcccaggacagactcatcgaggtgaatgggcagaacgtc
gaggggctgcgccatgcagaggtggtggccagcatcaaggcgagggaggatgaggcccgg
ctgctggtggtggaccctgagacggacgagtacttcaagcgactacgggtcacgcccact
gaggagcatgtggaaggtccactgccatcaccagtcaccaatgggaccagccctgcccag
atcaatggtggctcagcgtgctcgtcccgaagtgatctgcctggcttagacaaggacact
gaggacagcacctggaagcgggacccctttcaggagagcgggctccacctgagccccaca
gcggccgaagccaaggagaaggcgagagccacacgggtcaacaagcgggccccacagatg
gactggaaccggaaacgtgagatcttcagcaacttctga

DBGET integrated database retrieval system