KEGG   Ailuropoda melanoleuca (giant panda): 100470115Help
Entry
100470115         CDS       T01329                                 

Gene name
PRKAA1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100470115 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    100470115 (PRKAA1)
   04152 AMPK signaling pathway
    100470115 (PRKAA1)
   04150 mTOR signaling pathway
    100470115 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100470115 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100470115 (PRKAA1)
   04920 Adipocytokine signaling pathway
    100470115 (PRKAA1)
   04921 Oxytocin signaling pathway
    100470115 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    100470115 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100470115 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100470115 (PRKAA1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100470115 (PRKAA1)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100470115 (PRKAA1)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100470115 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    100470115 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 574 aa AA seqDB search
MRRLGSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RKSDVPGVVRTGSMKELDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAK
IADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPF
DDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPK
YLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIM
NEAKDFYLATSPPDSFLDDHHFTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA
KWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQV
DSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRNDSDAEAQGKSSEASLTSSV
TSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcggttcctggagaaagatggcgacagccgagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctgggggacacccttggcgtcggcaccttcggcaaa
gtgaaggttggcaaacatgaattgactgggcataaagttgctgtgaagatactcaatcga
cagaagattcgaagccttgatgtggtaggaaaaattcgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggaaatctgatgtacctggagtagtaagaacaggctccatgaaggagctggatgaaaaa
gaaagtcggcgtctgtttcaacagatcctttctggtgtggattactgtcacaggcatatg
gtggtccatagagatttgaaacctgaaaatgtcctgcttgatgcacacatgaatgcaaag
atagctgattttggtctttcaaacatgatgtcagatggtgaatttttaagaacaagttgc
ggctcacccaactatgctgcaccagaagtaatttcaggaagattgtatgcaggtccagag
gtagatatatggagcagtggggttattctttatgctttattatgtggaacccttccattt
gatgatgatcatgtgccaactctttttaagaagatatgtgatgggatcttttatacccct
cagtatttaaatccgtctgtgattagccttttgaaacatatgctacaggtggatcccatg
aagagggccacaatcaaagatatcagggaacatgaatggtttaaacaagatcttccaaaa
tatctttttcccgaggatccatcatacagttcaaccatgattgacgatgaagccttaaaa
gaagtatgtgaaaaatttgagtgctcagaagaggaggttctgagctgcctttataacaga
aatcaccaggaccctttggcagttgcctaccacctcataatagataacaggagaataatg
aatgaggccaaagatttttacttggcgacaagcccacctgattcttttctcgatgatcac
cacttcactcggccccatcctgaaagagtaccattcttggttgctgaaacaccaagagca
cgccacaccctcgatgaattaaatccacagaaatccaaacaccaaggtgtaaggaaagca
aaatggcatttgggaattagaagtcaaagtcgaccgaatgatatcatggcagaagtttgt
agagcaattaaacagctggattatgaatggaaggttgtaaacccctattatttgcgtgtt
cgaaggaagaatcctgtgacaagtacatactccaaaatgagtctgcagttataccaagtg
gatagtagaacatacttactggatttccgtagtattgatgatgaaattactgaagccaaa
tcagggactgctactccacagagatcgggatcagtaagcaactatcgatcttgccaaagg
aatgattcagatgctgaggctcaaggaaaatcctcagaagcttctcttacctcatctgtg
acctcacttgactcttctcctgttgacttaacaccaagaccaggaagtcacacaatagaa
ttttttgagatgtgtgcgaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system