KEGG   Ailuropoda melanoleuca (giant panda): 100470134Help
Entry
100470134         CDS       T01329                                 

Definition
uricase-like
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aml00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:aml00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 304 aa AA seqDB search
MAHYNNDYKKNEDVEFVRTGYGKDMVKVLHIQRNGKYHSIKEVATSVQLTLRSKKDYVHG
DNSDIIPTDTIKNTVHVLAKFKGIKSIETFAMNICDHFLSSFNHVTRAQVYVEEVPWKRF
EKNGVKHVHAFIHTPTGTHFCEVEQMRGGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTT
LPEVKDRCFATRVYCKWRYHQCRDMDFDATWDTVRDIVLEKFAGPYDKGEYSPSVQKTLY
DIQVHSLSRVPEIEDMEISLPNMHYFNIDMSNMGLINKEEVLLPLDNPYGRITGTVKRKL
ASKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcccattacaacaatgactataaaaagaatgaggacgtggagttcgtccgaactggc
tatgggaaggatatggtaaaagttctccatattcagcgcaatggaaaataccacagcatt
aaagaggtggcaacttcagtgcaactgactctgagatccaaaaaagattacgtgcatgga
gataattcagacatcatccccacagacaccatcaagaacacagttcatgtcttggcaaag
tttaaagggatcaaaagcatagaaacttttgcaatgaacatctgtgatcatttcctttct
tcttttaaccatgtcacccgagctcaagtctatgtggaagaagtcccttggaagcgtttt
gaaaagaatggagttaagcatgtccatgcatttattcacactcccactggaacgcacttc
tgtgaggttgaacagatgaggggtggacctccagtcattcattctggaatcaaagacctc
aaagtcttgaaaacgacccagtctggattcgaaggattcatcaaggaccagttcaccacc
ctccctgaggtgaaggaccggtgttttgcgactcgagtgtactgcaaatggcgctatcac
cagtgcagagacatggattttgatgctacctgggatactgttcgggacattgtcctggag
aaatttgctggaccctatgacaaaggcgagtactcaccctctgtccagaagaccctctac
gacatccaggtgcactctttgagccgggttcctgagatagaagacatggaaatcagcctg
ccgaacatgcactactttaatatagacatgtccaacatgggactgatcaacaaggaagag
gtcttgctaccattagacaatccatatggcagaattaccgggacggtcaagaggaagctg
gcttcgaagctgtga

DBGET integrated database retrieval system