KEGG   Ailuropoda melanoleuca (giant panda): 100470134Help
Entry
100470134         CDS       T01329                                 

Definition
uricase-like
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100470134
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100470134
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100470134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 304 aa AA seqDB search
MAHYNNDYKKNEDVEFVRTGYGKDMVKVLHIQRNGKYHSIKEVATSVQLTLRSKKDYVHG
DNSDIIPTDTIKNTVHVLAKFKGIKSIETFAMNICDHFLSSFNHVTRAQVYVEEVPWKRF
EKNGVKHVHAFIHTPTGTHFCEVEQMRGGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTT
LPEVKDRCFATRVYCKWRYHQCRDMDFDATWDTVRDIVLEKFAGPYDKGEYSPSVQKTLY
DIQVHSLSRVPEIEDMEISLPNMHYFNIDMSNMGLINKEEVLLPLDNPYGRITGTVKRKL
ASKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcccattacaacaatgactataaaaagaatgaggacgtggagttcgtccgaactggc
tatgggaaggatatggtaaaagttctccatattcagcgcaatggaaaataccacagcatt
aaagaggtggcaacttcagtgcaactgactctgagatccaaaaaagattacgtgcatgga
gataattcagacatcatccccacagacaccatcaagaacacagttcatgtcttggcaaag
tttaaagggatcaaaagcatagaaacttttgcaatgaacatctgtgatcatttcctttct
tcttttaaccatgtcacccgagctcaagtctatgtggaagaagtcccttggaagcgtttt
gaaaagaatggagttaagcatgtccatgcatttattcacactcccactggaacgcacttc
tgtgaggttgaacagatgaggggtggacctccagtcattcattctggaatcaaagacctc
aaagtcttgaaaacgacccagtctggattcgaaggattcatcaaggaccagttcaccacc
ctccctgaggtgaaggaccggtgttttgcgactcgagtgtactgcaaatggcgctatcac
cagtgcagagacatggattttgatgctacctgggatactgttcgggacattgtcctggag
aaatttgctggaccctatgacaaaggcgagtactcaccctctgtccagaagaccctctac
gacatccaggtgcactctttgagccgggttcctgagatagaagacatggaaatcagcctg
ccgaacatgcactactttaatatagacatgtccaacatgggactgatcaacaaggaagag
gtcttgctaccattagacaatccatatggcagaattaccgggacggtcaagaggaagctg
gcttcgaagctgtga

DBGET integrated database retrieval system