KEGG   Ailuropoda melanoleuca (giant panda): 100470180Help
Entry
100470180         CDS       T01329                                 

Gene name
USP44
Definition
ubiquitin specific peptidase 44
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 711 aa AA seqDB search
MLTMDKCKHIGQLRLAQDHSILNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKH
FQESSHPVALEVNEMYVFCYLCDDYVLNDNATGDLKLLRSMLSAIKSQNYQCTTRSGRVL
RSMGTSDDTYYLHDGTQSLLQNEDQMYTALWHRRRILMSKIFRTWFEQSPTGRKRQEEQF
QEKIAKREVKKRRQELEYQVKAELETIHPRKSLRLQGLAQSTTVEIVPVQVPLQTPASPA
KDKVVSTSEDVRLKKASDSSGKRRPIVTPGVTGLRNLGNTCYMNSVLQVLSHLLIFRQCF
LKLDLNQWLAVTASDKTRSPYKHPSITDTVYQMNECQETDTGSAPSRHPSLSLGLSGGAS
KSRKMELIQPREPSSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYAQ
QDAQEFLCELLDKIQHELETTGTRLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCLA
CDNKSNTIEPFWDLSLEFPERYQCNGKDIASQPCRVTEMLAKFTETEALEGKIYVCDHCN
SKRRRFSSKSVVLTEAQKQLMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNME
PYCCRESLKSLRPECFIYDLSAVVMHHGKGFGSGHYTAYCYNSEGGFWVHCNDSKLSMCT
MDEVCKAQAYILFYTQRVTENGHSKLLPPELLSGSQHPNEEADTSSNEILS
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgttaacaatggataagtgcaaacacattgggcagttgcggcttgctcaagaccattcc
atcctcaaccctcagaagtggcattgtgtggactgcaatacaactgagtcgatctgggct
tgccttagctgttctcatgttgcctgtggaagatacattgaagaacatgcactcaagcac
tttcaagaaagcagtcatcctgttgcattggaggtgaatgagatgtatgttttttgttac
ctttgtgatgattatgttcttaatgataatgcaactggagacctgaagttactacgaagt
atgttaagtgcaatcaaaagtcaaaattatcagtgcactactcgtagtggaagggttttg
cggtctatgggtacaagtgatgatacgtactacttacatgatggcacccaatctctgctt
caaaatgaagatcaaatgtatactgctctttggcacagaagaaggatattaatgagtaaa
atctttcgaacttggtttgagcaatcacccactggaagaaaaaggcaagaggaacaattt
caggaaaaaatagcaaaaagagaagtaaagaaaagacgacaagaattagagtatcaagtt
aaagcagaattggaaactatacatccaagaaagagtttacgtttgcaaggtctagctcaa
tctaccacagtagaaatagttcctgttcaagttccactacaaaccccagcatcaccagca
aaagataaagtagtatctacctcagaagatgtaaggttaaaaaaagccagtgactcctca
ggtaaacgaaggccgatagtaacccctggtgtaacaggattgagaaatttgggaaatact
tgctatatgaattctgttcttcaagtgttgagtcatttacttatttttcggcaatgtttt
ttaaaacttgatctgaaccaatggctggctgtgacagctagtgataagacaagatcacct
tataagcatccatcaatcacagatactgtatatcaaatgaatgaatgccaagaaacagat
acgggcagtgctccctccagacatccaagtttatcattaggactaagtggtggagcatca
aagagtagaaagatggaacttattcagccaagggagccaagttcacaatacatttctctc
tgtcatgaattgcatactttgttccaagtcatgtggtctggaaagtgggccttggtctca
ccatttgctatgctacactccgtgtggagactaattccagcttttcgtggttatgcccaa
caggatgctcaggaatttctttgtgaacttttggataaaatacaacatgaactagagaca
actggtactaggttaccagctcttatccccacttctcaaaggaaacttatcaaacaggtt
ctgaatgttgtgaataatatttttcatggacaacttcttagtcaggttacatgtctggca
tgtgacaacaaatcaaataccatagaacctttctgggacttatcactggaatttccagaa
agataccaatgcaatggaaaagatattgcttcccagccatgtcgggttactgaaatgctg
gccaaattcacagaaactgaagctttagaaggaaaaatctacgtatgtgaccactgtaac
tcaaagcgtaggaggttttcttcaaaatcagttgtactcacagaagcacaaaaacagctt
atgatttgccacctacctcaggttctcagactacatctcaaacgattcaggtggtcagga
cgtaataatcgagagaaaattggtgttcatgttggctttgaagagatcttaaacatggag
ccttattgctgcagggaatccctgaaatccctcagaccagaatgttttatctatgattta
tctgctgtagtaatgcaccatgggaaaggatttggctcaggacactacactgcctactgc
tataattctgaaggagggttctgggtacactgcaatgattccaagctaagcatgtgcact
atggatgaagtatgcaaggcccaagcttatatcttgttttatacccagcgagttactgag
aatggacattctaaactcttgcctccagaactcctgtctggtagccaacatcccaatgaa
gaagctgatacctcttctaatgaaatccttagctga

DBGET integrated database retrieval system