KEGG   Ailuropoda melanoleuca (giant panda): 100470193Help
Entry
100470193         CDS       T01329                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100470193 (MAPK7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100470193 (MAPK7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100470193 (MAPK7)
   04921 Oxytocin signaling pathway
    100470193 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100470193 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100470193 (MAPK7)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100470193 (MAPK7)
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100470193 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 798 aa AA seqDB search
MAEPLKEEEGEDGSAEPPGPVKAEPTNTAACVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPREPVPWETVXPAPPRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPSCPDVEMP
SPWAPSGDCAMESPPPAPPPCAGPAPDTIDLTLQPPLPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGTGTSGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPTPAPAPTPAPVPAHAPVPT
PSPAQPSSPPAGXXXXXXPQPACPPPGPAPHPASPSPLQTATSSLLAPQSLVPPPGLPGP
SAVGVLPYFPSGPPPPDPGGAPQLSTSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSG
AGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQRE
IQMDSPMLLADLPDLQEP
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacccctgaaggaggaagaaggcgaggacggctctgcggagccccccgggccg
gtgaaagcggaacccaccaacaccgctgcctgtgtagcggccaagaacctggccctgctc
aaagcccgctccttcgatgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaacggggcctatggggtggtgtcctctgcgcgccgccgtctcaccggccagcag
gtggccattaagaagatccctaatgcttttgacgtggtcaccaatgccaagcggaccctc
agggagctgaagattctcaaacacttcaagcacgacaacatcatcgccatcaaggacatc
ttgaggcccaccgtgccctatggcgagttcaaatctgtctatgtggtcctggacctgatg
gagagcgacctgcaccagatcatccactcctcccagccactcactctggagcacgcgcgt
tacttcctataccagctgctccggggcctcaagtacatgcactcggcccaggtcatccac
cgcgacctcaagccctccaacctgttggtgaatgagaattgtgagctcaagattggtgac
tttggcatggcccgtggcctgtgcacctcgcccgctgagcatcagtacttcatgaccgag
tacgtggccacacgctggtaccgtgctcctgagctcatgctctcgctgcacgagtacacg
caggccatcgacctgtggtctgtgggctgcatctttggtgagatgctggcgcggcgccag
ctcttcccaggcaaaaattacgtacaccagctgcagctgatcatgatggtgctgggcacc
ccatcgccggccgtgatccaggctgtgggggctgagagggtgcgggcctacatccagagc
ctgccaccacgtgagcctgtgccctgggagaccgtgnccccggcccccccccgccaggcc
ctgtcactgctggggcgcatgttgcgtttcgagcccagcgcccgcatttccgcagctgct
gcccttcgccaccccttcctggccaagtaccatgaccctgacgacgagcctgactgtgcc
ccgccttttgattttgcctttgaccgcgaagccctcactcgggagcgcattaaagaggcc
atagtggctgagatcgaggacttccatgcacgacgagagggcatccgccagcagatccgc
ttccagccttccctgcagccggtggccagtgagcccagctgccctgatgttgagatgcct
agtccctgggctcccagtggggactgtgccatggagtcgcctccgccagcaccaccgcca
tgtgccggccccgcacccgacaccattgacctgaccctgcagccgcccctgccagccagt
gaaccagcccctccaaagaaggagggtgccatctcagacaacaccaaggcggccctcaaa
gctgccctgctcaagtccttgcggagccggctcagagatggccccagcgctcccctggaa
gctcctgagcctcggaagccggtcaccgcccaggagcgccagcgggagagggaggagaag
cggcggaggcggcaggagcgagccaaggagcgggagaagcggcggcaggagcgggagcgc
aaggagcgggggaccgggacctctgggggcccatccaccgatcccctggccgggctggtg
ctcagtgacaacgatcgcagcctgctggagcgctggactcgcatggcccggcccccagcc
cccacgccagccccagccccaacaccagccccagtgccagcccacgcccccgtcccaacg
cccagcccagcgcagcccagcagccctcctgctggnnnnnnnnnnnnnnnnnnaccgcag
cccgcctgcccaccccctggccctgctccccaccctgccagcccttctccactccagact
gccacctctagcctcctggccccccagtcgcttgtgccaccccctgggctgcctggcccc
agtgctgtaggtgttctgccttacttcccatctggcccaccccctccagaccctggaggg
gcccctcagctctccacctcagaatcacccgacgtgaacctggtgactcagcagctgtcc
aagtcacaggtggaggaccccttgccccccgtcttttcgggcactccaaagggcagtggg
gccggctatggtgttggttttgacctggaggagttcctaaaccaatcttttgatatgggc
gtggctgacgggccacaggatggccaggcggactcagcctcactctcggcttccctgctt
gctgactggctggagggccacggcatgaaccctgccgacattgagtccctgcagcgtgag
atccagatggactccccaatgctgctggctgacctgccggacctccaggagccctga

DBGET integrated database retrieval system