KEGG   Ailuropoda melanoleuca (giant panda): 100470193Help
Entry
100470193         CDS       T01329                                 

Definition
mitogen-activated protein kinase 7-like
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100470193
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100470193
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100470193
   04921 Oxytocin signaling pathway
    100470193
  Nervous system
   04722 Neurotrophin signaling pathway
    100470193
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100470193
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100470193
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100470193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 794 aa AA seqDB search
MAEPLKEEEGEDGSAEPPGPVKAEPTNTAACVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPREPVPWETVXPAPPRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPSCPDVEMP
SPWAPSGDCAMESPPPAPPPCAGPAPDTIDLTLQPPLPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGTGTSGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPTPAPAPTPAPVPAHAPVPT
PSPAQPSSPPAGXXPQPACPPPGPAPHPASPSPLQTATSSLLAPQSLVPPPGLPGPSAVG
VLPYFPSGPPPPDPGGAPQLSTSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYG
VGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMD
SPMLLADLPDLQEP
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacccctgaaggaggaagaaggcgaggacggctctgcggagccccccgggccg
gtgaaagcggaacccaccaacaccgctgcctgtgtagcggccaagaacctggccctgctc
aaagcccgctccttcgatgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaacggggcctatggggtggtgtcctctgcgcgccgccgtctcaccggccagcag
gtggccattaagaagatccctaatgcttttgacgtggtcaccaatgccaagcggaccctc
agggagctgaagattctcaaacacttcaagcacgacaacatcatcgccatcaaggacatc
ttgaggcccaccgtgccctatggcgagttcaaatctgtctatgtggtcctggacctgatg
gagagcgacctgcaccagatcatccactcctcccagccactcactctggagcacgcgcgt
tacttcctataccagctgctccggggcctcaagtacatgcactcggcccaggtcatccac
cgcgacctcaagccctccaacctgttggtgaatgagaattgtgagctcaagattggtgac
tttggcatggcccgtggcctgtgcacctcgcccgctgagcatcagtacttcatgaccgag
tacgtggccacacgctggtaccgtgctcctgagctcatgctctcgctgcacgagtacacg
caggccatcgacctgtggtctgtgggctgcatctttggtgagatgctggcgcggcgccag
ctcttcccaggcaaaaattacgtacaccagctgcagctgatcatgatggtgctgggcacc
ccatcgccggccgtgatccaggctgtgggggctgagagggtgcgggcctacatccagagc
ctgccaccacgtgagcctgtgccctgggagaccgtgnccccggcccccccccgccaggcc
ctgtcactgctggggcgcatgttgcgtttcgagcccagcgcccgcatttccgcagctgct
gcccttcgccaccccttcctggccaagtaccatgaccctgacgacgagcctgactgtgcc
ccgccttttgattttgcctttgaccgcgaagccctcactcgggagcgcattaaagaggcc
atagtggctgagatcgaggacttccatgcacgacgagagggcatccgccagcagatccgc
ttccagccttccctgcagccggtggccagtgagcccagctgccctgatgttgagatgcct
agtccctgggctcccagtggggactgtgccatggagtcgcctccgccagcaccaccgcca
tgtgccggccccgcacccgacaccattgacctgaccctgcagccgcccctgccagccagt
gaaccagcccctccaaagaaggagggtgccatctcagacaacaccaaggcggccctcaaa
gctgccctgctcaagtccttgcggagccggctcagagatggccccagcgctcccctggaa
gctcctgagcctcggaagccggtcaccgcccaggagcgccagcgggagagggaggagaag
cggcggaggcggcaggagcgagccaaggagcgggagaagcggcggcaggagcgggagcgc
aaggagcgggggaccgggacctctgggggcccatccaccgatcccctggccgggctggtg
ctcagtgacaacgatcgcagcctgctggagcgctggactcgcatggcccggcccccagcc
cccacgccagccccagccccaacaccagccccagtgccagcccacgcccccgtcccaacg
cccagcccagcgcagcccagcagccctcctgctggnnnnnnaccgcagcccgcctgccca
ccccctggccctgctccccaccctgccagcccttctccactccagactgccacctctagc
ctcctggccccccagtcgcttgtgccaccccctgggctgcctggccccagtgctgtaggt
gttctgccttacttcccatctggcccaccccctccagaccctggaggggcccctcagctc
tccacctcagaatcacccgacgtgaacctggtgactcagcagctgtccaagtcacaggtg
gaggaccccttgccccccgtcttttcgggcactccaaagggcagtggggccggctatggt
gttggttttgacctggaggagttcctaaaccaatcttttgatatgggcgtggctgacggg
ccacaggatggccaggcggactcagcctcactctcggcttccctgcttgctgactggctg
gagggccacggcatgaaccctgccgacattgagtccctgcagcgtgagatccagatggac
tccccaatgctgctggctgacctgccggacctccaggagccctga

DBGET integrated database retrieval system