KEGG   Ailuropoda melanoleuca (giant panda): 100470220Help
Entry
100470220         CDS       T01329                                 

Gene name
GYS2
Definition
glycogen synthase 2 (liver)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100470220 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100470220 (GYS2)
   04152 AMPK signaling pathway
    100470220 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100470220 (GYS2)
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100470220 (GYS2)
Glycosyltransferases [BR:aml01003]
 Polysaccharide
  Storage polysaccharide
   100470220 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEVEELPIEDVLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVEQCEPVNDTVRRAMDSMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDNADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLEALSRLNFLLRVHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMDNIL
DRDDVTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARYLTLSRAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVSSPQSSDVE
DEEDDERYNEEEEAERDRLNIKSPFSLGRVPRGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatctctatcagtgacatccctgagcgggcttcctcagtgggaagtt
gaagaacttcccatagaggatgtactgctctttgaagtcgcgtgggaagtaaccaataaa
gttggtggcatctatactgtgattcagacgaaggccaaaaccacagcagatgaatgggga
gacaattattttctgattggcccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatactgttagaagagcaatggactcaatgaataaacatggctgc
caggtgcactttggaagatggctgatagaggggagtccttatgtggtgctcttcgacata
ggctattcggcttggaacctggaccggtggaagggtgacctctgggaagcgtgcagtgtc
ggcataccttatcatgaccgagaagccaacgatatgctgatattcggatctttaactgcc
tggttcctaaaagaggtgacagataatgcggatgggaagcatgtcattgcccaattccat
gaatggcaggcgggaactggactgatcctttctcgagctcggaaacttcccatcgctacc
atatttaccactcatgccacactgcttgggaggtatctctgtgcagcaaacatcgatttc
tacaaccatctcgataagtttaacatagacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagagggcctctgtccattgtgctcatgtgttcaccacagtatctgaa
ataacagcaatagaagcagagcatatgctgaagaggaagcctgatgtagttactccaaat
ggcttgaacgttaagaaattttcagcagtgcatgagtttcaaaatttacatgccatgtac
aaggccaggatccaagattttgttcgaggtcatttctatggtcatctggactttgatctt
gaaaagactttgttccttttcattgctgggagatatgagttttcaaacaaaggagctgac
atcttcctagaagccttatccaggctaaattttctgctgagggtgcataaaagtgacgtc
acagtggtggtgtttttcatcatgcctgccaagacaaataatttcaatgtggaaacgctg
aaaggccaggcagtgcggaaacagctatgggacattgcacattctgtgaaggaaaaattt
gggaagaaactctatgatgctttgttaagaggagaaattcctgacatggacaatattttg
gatcgagatgatgtaacaattatgaaaagagccatcttctcaactcagcgacagtctttg
cctcctgtgaccactcacaacatgattgatgactccactgatcccatcctcagcaccatt
agacggatcggacttttcaacagccgcacagacagagtcaaggtgattttgcacccagag
tttctatcctccaccagccccttattacccatggattatgaagagtttgtccgaggttgt
catcttggagtatttccatcatactatgaaccgtggggttatactccggctgaatgcact
gtgatgggtatccccagtgtgacgaccaacctttccggctttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacattgttgacaggcggttccgttctcca
gatgattcctgcaatcagctgactcagtttctctatggattttgcaaacagtcacgccgc
caaagaattattcagagaaaccgaactgagaggctctccgatcttctggattggagatac
ttgggcagatattatcaacacgccaggtacctgacgttaagcagagcttttccagataaa
ttccatatggagcctacatcaccacccacgacggaaggatttaaataccccaggccttcc
tcagttccaccttccccttcagggtctcaggtctctagtcctcaaagcagtgatgtggaa
gatgaagaagacgatgagcggtacaatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcgccattttctctgggccgtgttcctcgtgggaagaaaaagctgcatggtgaa
tacaagaactga

DBGET integrated database retrieval system