KEGG   Ailuropoda melanoleuca (giant panda): 100470246Help
Entry
100470246         CDS       T01329                                 

Definition
AMSH-like protease-like
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100470246
Peptidases [BR:aml01002]
 Metallo Peptidases
  Family M67
   100470246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 432 aa AA seqDB search
MDQPFTVNSLKKLAALPDHTDVSLSPEERVRALSKLGCNITITEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKKDLLKKYNVEYQEYLQSKNKYKAEILKQLEHQSLIEAERKRVARMRQQQLESEQFLFF
EDQLKKQELARGQTRSQETPARAEQTDGSALSCLSAHRNHALLDVFADQPRKSEAAPDAX
LNRALKPAAALSAVQNLVVEGLRCVVLSRDLCHRFLLLAESNTVRGVETCGILCGKLTHN
EFTITHVIVPKQSAGPDYCDVENVEELFGVQDQHGLLTLGWIHTHPTQTAFLSSVDLHTH
CSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKDPRLFSICKHVL
VKDIKITMLDLR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccatttactgtgaattctctgaagaagctagccgctctgcctgaccacacg
gatgtttccctgagcccggaagagcgagtgcgcgccctcagcaagctcggctgtaacatc
accatcacggaagacatcacaccgcgtcgctacttcaggtccggggtggagatggagagg
atggcgtcggtctatttggaagaaggaaatttggaaaacgccttcgtcctttataataag
tttataaccttgtttgtagaaaagcttcccagccatcgagattaccagcaatgtgcagtc
ccagaaaagcaggatattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaaggaccttttaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aacaaatacaaggcagaaatcctcaaacaactggagcatcagagcctgatcgaggccgag
aggaagcgcgtggctcggatgcggcagcagcagctggagtcggagcagttcctgttcttc
gaagaccagctcaagaagcaggagttggcacgggggcagacgcgaagtcaggagaccccg
gcgcgggcggagcagacagacgggagcgctctgtcctgcttgtcggcgcaccgcaaccac
gcgctgctggacgtgttcgcagaccagccgcggaagagcgaggcggcccctgacgccnat
ctgaaccgggcgctaaagcccgcggccgctctgagcgccgtgcagaatttagtggtcgaa
ggactgcggtgtgtagttttatcaagagacctttgccacagatttctgctgctggcagaa
tctaataccgtgagaggagtagaaacgtgtggaatactgtgtggaaaactgacacataat
gaatttactatcacccatgtaatcgtgcccaagcagtccgcggggccggactactgtgac
gtggagaacgtggaagaattattcggcgttcaggaccaacacggcctcctcacgctgggg
tggatccacacacatccgacccaaactgcattcctgtccagtgttgatcttcacactcac
tgttcctatcagctcatgctgccagaggccattgccattgtttgttcgccaaagcataaa
gacacgggtattttcaggctcaccaatgccggcatgcttgaggtttctgcttgtaagaag
aagggctttcatccacacaccaaggaccccagactgttcagtatttgcaaacatgtgttg
gtaaaagacataaaaataaccatgctggatctaaggtga

DBGET integrated database retrieval system