KEGG   Ailuropoda melanoleuca (giant panda): 100470246Help
Entry
100470246         CDS       T01329                                 

Gene name
STAMBPL1
Definition
(RefSeq) STAM binding protein-like 1
  KO
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100470246 (STAMBPL1)
Peptidases [BR:aml01002]
 Metallo Peptidases
  Family M67
   100470246 (STAMBPL1)
Ubiquitin system [BR:aml04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    100470246 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 432 aa AA seqDB search
MDQPFTVNSLKKLAALPDHTDVSLSPEERVRALSKLGCNITITEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKKDLLKKYNVEYQEYLQSKNKYKAEILKQLEHQSLIEAERKRVARMRQQQLESEQFLFF
EDQLKKQELARGQTRSQETPARAEQTDGSALSCLSAHRNHALLDVFADQPRKSEAAPDAX
LNRALKPAAALSAVQNLVVEGLRCVVLSRDLCHRFLLLAESNTVRGVETCGILCGKLTHN
EFTITHVIVPKQSAGPDYCDVENVEELFGVQDQHGLLTLGWIHTHPTQTAFLSSVDLHTH
CSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKDPRLFSICKHVL
VKDIKITMLDLR
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccatttactgtgaattctctgaagaagctagccgctctgcctgaccacacg
gatgtttccctgagcccggaagagcgagtgcgcgccctcagcaagctcggctgtaacatc
accatcacggaagacatcacaccgcgtcgctacttcaggtccggggtggagatggagagg
atggcgtcggtctatttggaagaaggaaatttggaaaacgccttcgtcctttataataag
tttataaccttgtttgtagaaaagcttcccagccatcgagattaccagcaatgtgcagtc
ccagaaaagcaggatattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaaggaccttttaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aacaaatacaaggcagaaatcctcaaacaactggagcatcagagcctgatcgaggccgag
aggaagcgcgtggctcggatgcggcagcagcagctggagtcggagcagttcctgttcttc
gaagaccagctcaagaagcaggagttggcacgggggcagacgcgaagtcaggagaccccg
gcgcgggcggagcagacagacgggagcgctctgtcctgcttgtcggcgcaccgcaaccac
gcgctgctggacgtgttcgcagaccagccgcggaagagcgaggcggcccctgacgccnat
ctgaaccgggcgctaaagcccgcggccgctctgagcgccgtgcagaatttagtggtcgaa
ggactgcggtgtgtagttttatcaagagacctttgccacagatttctgctgctggcagaa
tctaataccgtgagaggagtagaaacgtgtggaatactgtgtggaaaactgacacataat
gaatttactatcacccatgtaatcgtgcccaagcagtccgcggggccggactactgtgac
gtggagaacgtggaagaattattcggcgttcaggaccaacacggcctcctcacgctgggg
tggatccacacacatccgacccaaactgcattcctgtccagtgttgatcttcacactcac
tgttcctatcagctcatgctgccagaggccattgccattgtttgttcgccaaagcataaa
gacacgggtattttcaggctcaccaatgccggcatgcttgaggtttctgcttgtaagaag
aagggctttcatccacacaccaaggaccccagactgttcagtatttgcaaacatgtgttg
gtaaaagacataaaaataaccatgctggatctaaggtga

DBGET integrated database retrieval system