KEGG   Ailuropoda melanoleuca (giant panda): 100470322Help
Entry
100470322         CDS       T01329                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100470322 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100470322 (PIK3CG)
   04072 Phospholipase D signaling pathway
    100470322 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    100470322 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    100470322 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100470322 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    100470322 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100470322 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    100470322 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100470322 (PIK3CG)
   05145 Toxoplasmosis
    100470322 (PIK3CG)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100470322 (PIK3CG)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100470322 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1102 aa AA seqDB search
MELENYEQPVVLREDNRRRRRRMKPRSSAASLSSMELIPIEFVLPTSQRHSKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKHQVVQTLD
CLRYWQVLHRSPGQIHVVQRRAPSDETLAFQRQLTALIGYDVTDVSNVHDNELEFTRRRL
VTPRMVEVAGRDPKLYAMHPWVTSKPLPEYLLKKISNNCIFIVIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLLDIPESQNEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG
EEIHLVLDSPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIQI
KDLPRGALLNLQIYCSKAPAPSGKGSADTPGSEGKGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQISGKGEDQGSFSADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVLLEAY
LRGCGTAMLHDFSQQVHVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNSNLP
KSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEEAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactatgagcagcctgtggttctgagagaggacaaccgccgccggcgc
cggaggatgaagccgcgcagctccgcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgccacagcaagacccccgagacggcgctgctgcac
gtggccggccacggcaatgtggagcagatgaaggcccaggtgtggctgcgcgcactggag
acgagcgtggcggccgacttctaccaccggctcggcccggaccacttcctcctgctctac
cagaagaagggccagtggtacgagatctacgacaagcaccaggtggtgcagaccctggac
tgcctgcgctactggcaggtgctgcaccggagcccgggccagatccacgtggtgcagagg
cgcgcgccgtccgacgagacgctggccttccagcgccagctcaccgccctgatcggctac
gacgtcaccgacgtcagcaacgtgcacgacaacgagctcgagttcacgcgccgccgcctg
gtcactccgcgcatggtcgaggtggccggccgcgaccccaagctctacgccatgcacccg
tgggtgacctccaagcctctcccggagtacctgctgaagaagattagcaacaactgcatc
ttcatcgtcattcaccgcagcaccaccagccagaccatcaaggtctcggccgacgacacc
ccgggcaccatcctccagagcttcttcaccaagatggccaagaagaagtctctgctggat
atccccgagagccaaaacgaacaggattttgtgctgcgcgtctgcggccgggacgagtac
ctggtaggcgaaacgcccatcaagaacttccagtgggtgaggcattgcctcaagaacgga
gaagagattcacctggtgctggactcgcctccagacccggccctggacgaggtgaggaaa
gaagagtggccgctggtagatgactgcacgggagtcaccggctaccacgagcagctgact
atccacgggaaggaccatgagagtgtgttcaccgtgtccctgtgggactgcgaccggaag
ttcagggtcaaaatcagaggcattgatatccctgtgctgccccggaacgctgacctcaca
gtttttgtggaggccaacatccagcacgggcagcaggtcctgtgccaaaggagaacgagc
cccaaacccttcacggaggaggtgctctggaacgtgtggcttgagttcagtatccaaatc
aaagacttacccaggggggctctgctgaacctccagatctactgcagcaaagctccggcg
ccgtccggcaagggctccgcggacactccgggctcggagggcaaaggcaaagcgcagctg
ctctattatgtgaacctgctgctgatcgaccaccggttcctgctgcgccacggggagtac
gtgctccacatgtggcagatctcgggaaagggagaagaccaggggagcttcagtgctgac
aagctcacgtcggcgaccaacccagacaaggagaactccatgtcaatctccattcttctg
gacaattactgtcacccaatcgccttgcccaagcatcggccaacccctgaccccgaaggg
gaccgggtgcgagcggagatgcccaatcagcttcggaagcaactggaggcgatcatagcc
acggatccacttaaccccctcacggcagaggacaaagaactgctctggcattttagatac
gaaagtcttaagcatccaaaggcctatcccaagctgtttagctccgtaaaatggggacag
caagaaattgtagccaaaacataccaactgttagccagacgggaggtctgggaccaaagt
gctttggatgttgggttaacgatgcaacttctggactgcaacttttcagatgaaaatgta
agagccatcgcagttcagaagctggagagcttggaggacgatgatgtcctgcattacctg
ctacagctggtccaggccgtgaaattcgagccatatcatgacagcgccctggcccgattt
ctgctgaaacgaggcttaaggaacaaaagaattggccatttcttgttttggttcttgaga
agcgagatagcccagtccaggcactatcagcagaggtttgccgtgctcctggaggcctat
ctgaggggctgcggcacggccatgctgcacgacttctcccaacaagttcacgtgatcgag
atgctgcagaaggtcaccattgatattaaatcactctctgcggaaaagtatgacgtcagt
tcccaagttatttcacaacttaagcaaaagctcgaaaacctgcagaattcgaatctcccg
aagagctttagagtgccgtacgatcctggactgaaggcaggagcactagtgattgaaaaa
tgtaaagtgatggcctccaagaaaaagcccctgtggcttgagtttaaatgtgctgaccct
acagccctatccaatgaaacaattggaattatctttaaacacggtgatgatctgcgccaa
gacatgctgattttacagattctgcgaatcatggaatccatttgggagactgaatctttg
gatctgtgcctcctgccatatggttgcatttcaactggggacaaaataggaatgatcgag
atcgtgaaagatgccacaacaattgccaaaattcagcaaagtacagtgggcaatacgggc
gcgttcaaagatgaagtcctgaatcactggctcaaagaaaaatgccctattgaagagaag
ttccaggcagcagtggagagatttgtttattcctgcgctggctactgtgtggctaccttt
gttcttggaataggcgacaggcacaatgacaatattatgatcacagagacaggaaaccta
tttcatattgactttggacacattcttgggaattacaaaagtttcctgggcattaataaa
gaaagagtgccgtttgtgctaaccccagacttcctgttcgtgatgggaacttctggaaag
aagacaagcctacacttccaaaaatttcaggacgtctgtgtcaaggcttacctagccctt
cgtcaccacacaaatctgctgatcatcctgttctccatgatgctaatgacgggaatgccc
cagttaacaagcaaagaagacatcgaatatattcgggatgccctaacagtggggaagaac
gaggaggaagctaagaagtattttcttgatcagatcgaagtttgcagggacaaaggatgg
actgtgcagtttaactggttcctgcaccttgttctgggcatcaaacaaggagagaaacat
tcagcctaa

DBGET integrated database retrieval system