KEGG   Ailuropoda melanoleuca (giant panda): 100470829Help
Entry
100470829         CDS       T01329                                 

Definition
tyrosine-protein phosphatase non-receptor type 7-like
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100470829
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100470829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 524 aa AA seqDB search
MVAEFYRVAAFDAVAGSSLACSPASLLFTGEISFQLLKLLLGPALGRAGYYSSSTFQGNH
PLPRVKKGPGPAGPGGAQKGAVSGHLPAFQEKHQALEGLRSSKGCRLTVRCRSRAWCQKA
GSWPGLGAFSWPVGQARGQQLRALSFRXNSWLSEPPLGPAPHPSMVQDCGGCSRAQLPTW
SLGAAMTQPPPAKAPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLR
TAGHPLTRWALQHQPPSPKQLEEEFLKIPSNFVNPEDLDIPGHASKDRYKTILPNPQSRV
CLGRAQSQEDGDYINANYIRGYDGQEKVYIATQGPMPNTVLDFWEMVWQEEVSLIVMLTQ
LREGKEKCVHYWPTEEETYGPFRLRIQDTKECLEYTVRQLTIQHQEKCRGLKHILFSAWP
DHQTPESAAPLLRLVAEVEESPETAANTGPIVVHCSAGIGRTGCFIATRIGCQQLKARGE
VDILGIVCRLRLDRGGMIQTTEQYQFLHHTLALYAAQLPEEPCP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagaattttacagggtggcagcctttgacgctgtggctggcagcagcctggcc
tgctccccagcttccttgctcttcaccggagaaatcagcttccagctcctcaaactgctg
ctgggcccagccttgggaagggctggctactactccagctccacctttcagggaaaccac
ccactccccagagtgaagaagggtcccggaccagctggccctggaggggctcagaaagga
gccgtgtctggtcacctccccgccttccaggagaaacatcaggcgctggaaggcctccgg
agctccaaaggctgtcgcctcaccgtgcgctgccgctcaagggcttggtgccagaaagca
ggcagctggcctgggttgggagccttctcctggccagttggacaggccagaggtcagcag
ctgagggccctgtctttcaggtgaaactcatggctgagtgagcctcccctgggcccagca
ccccaccccagcatggtccaggactgtggggggtgctccagagcacagctgccgacttgg
tctctgggggcagccatgacccagcctccacccgccaaggcaccagccaagaagcatgtg
cggctgcaggagaggcggggctccaatgttgctttgatgctggatgtgaggtccctgggg
gccgtggaacccatttgctcagtgaacactccccgggaggtcaccctacactttctgcgc
acagctggacacccactcacccgctgggccctgcagcatcagccacccagccccaagcag
ctggaagaggaattcttgaagatcccctcaaactttgtcaaccctgaagacctggatatt
cctggccatgcctccaaggaccggtataagaccatcttgccaaatccccagagccgagtc
tgtctaggccgggcacagagccaagaagacggagactacatcaacgctaactacatccga
ggctacgatgggcaggagaaggtctacattgcgacccagggccccatgcccaacactgtg
ttggacttctgggagatggtgtggcaggaagaagtgtcactcattgtcatgctcactcag
ctccgagagggcaaggagaaatgtgtccactactggcccacagaggaggaaacctatgga
cccttccggctccgcatccaagacacaaaagagtgcctggaatacaccgtgcggcagctc
accatccagcaccaggagaagtgccgggggctgaagcacatcctcttctccgcctggcct
gaccaccagaccccagaatcggctgcgcccctgctgcgcctggtggccgaggtggaggag
agcccagagacagctgccaacactgggcccatcgtggtccactgcagtgcagggatcggc
cggactggctgcttcattgccacccgaattggctgtcagcagctgaaggcccgcggggaa
gtggacatcctgggcatcgtgtgccggctgcggctggacaggggtggaatgatccagacc
acggagcagtaccagttcctgcatcacactctggccctgtatgcggcccagctgccggag
gagccctgcccctga

DBGET integrated database retrieval system