KEGG   Ailuropoda melanoleuca (giant panda): 100470910Help
Entry
100470910         CDS       T01329                                 

Gene name
USP51
Definition
ubiquitin specific peptidase 51
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100470910 (USP51)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100470910 (USP51)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100470910 (USP51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 703 aa AA seqDB search
MAQVRETSLPSGSLVRWSSGSGGGASPEEAAEKAGEMEKEAVGAAKACSGLGAEEMKLDP
LQEHKPAPENLTWSDGGGDNKVLPSTPPRCYSSSSPLCPRRKPRPRPQPRARSRGPPGLS
APPLPPSHPSPPPLTGPQPWRRPRRRSRPASRPQMLHSCSSELGGSGDRGGLGDWLLEVE
FDQGPTGCTHVESFKVAKNWRKNLRLIYQRFVWSGTPETRKHKAKSCICHVCSTHMNRLH
SCLACVFFGCFTEKHIHKHAETKQHNLAVDLYRGVIYCFMCKDYVYDKDMERIAKETKEK
NLKLTSTSTDVSQQQCMTSGVEERHSTCESKEQEPKLVKPKKKRRKKSVYTIGLRGLINL
GNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFNAMYSGSRTPHIP
YKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSIGQEANNPNCCNCIIDQIF
TGGLQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFSSQSPERADSTVSRDDHIPGIPS
LTDCLQWFTRPEYLGSNSKIKCSSCQSYQESIKQLTMKKLPVVACFHLKRFEHVGKQRRK
INTFISFPLELDMTPFLASTKESRMKEGQPQTDCTSNENKYSLFAVINHHGTLESGHYTS
FIRQQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHKQGLEKD
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagttcgggaaacttccttgccctccggctctttggtccgctggagctcggga
agtgggggaggagcctctcccgaggaggcggctgaaaaggcgggggaaatggagaaggag
gcggtgggggcggcaaaggcgtgttcaggcctgggagctgaggagatgaagctggaccca
ttacaagagcataagcctgctcctgagaacttgacgtggagtgacggcggcggcgataat
aaggtgctcccttcaacccctcctcgctgttacagcagctcctcgcccctttgcccgcgc
cgcaagccccgccctcggccccagccccgggcccgctcgcgagggccgcctggtctctcc
gccccacccctgcctccatcccatccttcccctccgcctctgaccggaccccagccctgg
cgcagaccgcggcgtagatccaggccggcgtctaggccccagatgctgcacagctgttct
agtgaattaggtggctctggggatcgaggtggtttaggggactggttgctggaggtggag
tttgatcagggtcctacaggctgcacgcacgtggagagctttaaagtggctaagaactgg
cggaagaacctgaggttgatttaccagcgtttcgtatggagtgggaccccagaaactagg
aaacataaggcaaagtcgtgcatctgccatgtatgtagtacccatatgaacagactccac
tcttgtctcgcctgtgtcttttttggctgctttactgagaaacatattcataaacatgca
gaaacaaaacagcacaatttagccgtagacctctatcgtggggttatatattgctttatg
tgtaaggattatgtatatgacaaagacatggaacgaattgccaaagaaacaaaagagaaa
aatttgaaattaacttccacctcaacagatgtttctcaacaacagtgtatgacatcaggt
gttgaagagaggcattcaacctgtgagtcaaaggaacaagagccaaaattggtgaaaccc
aagaaaaagaggagaaaaaagtcagtctataccataggcctgagagggctaatcaatctt
gggaacacatgctttatgaattgtattgtccaggcacttacccatattcctctattgaaa
gatttctttctctctgacaagcataaatgtataatgacaagccccagcttgtgtcttgtc
tgtgaaatgtcttctctttttaatgctatgtactctgggagccgaactcctcacattccc
tataagttattgcatctaatatggattcatgcagaacacttagcagggtacaggcagcag
gatgcccatgagttcctcattgcaatattagatgtgctgcatagacacagcaaagacgat
agcattgggcaggaggccaataaccccaactgctgtaactgcatcatagaccaaatcttt
acaggtggcttgcaatcagatgtcacatgtcaagcttgtcatagtgtctctaccacaata
gacccatgctgggacatcagtttggacttgcctggctcttgtgccacattcagttcccag
agtccagagagagctgatagcacagtgagtagggatgaccacataccaggaatcccctca
ctcacagactgcctacagtggtttacaaggccagagtacctaggaagcaattccaaaatc
aaatgcagtagttgccaaagctatcaggaatctatcaaacaactcacaatgaagaaatta
cctgttgtggcctgttttcatctcaagcgatttgagcatgtaggtaaacagaggcggaag
attaatacttttatctcctttcccttggagctggacatgactccatttttggcctccact
aaggagagcagaatgaaagaaggccagccacaaacagattgtacatccaacgagaataaa
tattccttgtttgcagtgattaatcaccatggaactttggaaagtggacactacaccagc
tttatccggcaacaaaaggaccaatggtttagctgtgatgatgccatcatcaccaaggct
accattgaggacttactctacagtgaagggtatttactgttttatcacaaacagggtcta
gagaaagattag

DBGET integrated database retrieval system