KEGG   Ailuropoda melanoleuca (giant panda): 100470997Help
Entry
100470997         CDS       T01329                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100470997
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100470997
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100470997
  Exosomal proteins of colorectal cancer cells
   100470997
  Exosomal proteins of bladder cancer cells
   100470997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 621 aa AA seqDB search
MSGWSCPGALEGPMGSGPKGPLLDDKMKWHFLPRQDAAEAPVLDSTCHRGNEGGCPKSER
DLAVAARGHTVITSIKVRQLQPRRHRLNRRAASTAIPNPGSGASAFGQSENFEGGPWSPP
XXXXXXXXXXXXPEEEDHVLVLHKGNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAA
GKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTAAPREYTAGREAEDIVN
WLKKRTGPAATTLSDGAAAEALLESSEVTVIGFFKDVESDFAKQFLLAAEAIDDIPFGIT
SNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGDVTKDKLLDFIKHNQLPLVIEFTEQTAPK
IFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAERFKGKILFIFIDSDHTDNQRILEFFGL
KKEECPAVRLITLEEEMTKYKPESDELTAEKIEEFCHRFLEGKIKPHLMSQELPEDWDKQ
PVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDS
TANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDL
EEAEEPDLEEEDGQRAARDEL
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctggtcctgccccggtgccctggagggcccgatgggatcgggtccaaagggc
cccctgctggacgacaagatgaagtggcacttcctgcccagacaggacgcagcagaggcc
cccgttcttgattccacatgccacaggggcaatgaggggggctgccccaagtcagaacgt
gacttggctgtggccgcccggggccacaccgtcatcacctccatcaaggtgcgtcagctg
cagccacggaggcacagactcaacagaagggcagcctccacagcgattccgaatccgggg
tcgggggccagcgcatttggccaatccgagaacttcgaaggcgggccttggagtccgcca
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnccccggaggaggaggaccacgtcttg
gtgctccacaagggcaacttcgaggaggcgctggcggcccacaagtacctgctggtggag
ttctatgccccttggtgtggccactgcaaggctctggcccccgagtacgccaaagccgct
gggaaactgaaggcggagggttcggagatcaggctggcaaaggtcgatgccacggaagag
tccgacctagcccagcagtacggtgttcgtggctaccctacgatcaagttcttcaagaat
ggagacacagctgctcccagggagtacacagctggcagagaagctgaggacatcgtgaac
tggctgaagaagcgcacaggccctgctgccaccacgctgtccgacggggccgccgcggag
gccttgctggagtccagcgaggtgaccgtcattggcttcttcaaggacgtggagtcggac
tttgccaagcagttcttgctggcagcagaggccattgatgacataccttttgggatcaca
tccaacagtgatgtgttctccaaataccagctggacaaggacggggttgtgctcttcaag
aagtttgacgaaggccgcaacaatttcgagggggacgtcaccaaggacaagttgttggac
ttcatcaagcacaaccagctgccgctggtcatcgagttcacggagcagacagccccaaag
atcttcggaggtgaaatcaagacccacatcctgctgttcctgcccaagagcgtgtctgac
tacgacggcaaactgagcaacttcaagaaggccgctgagcgcttcaaggggaagatcctg
ttcatcttcatcgacagtgaccacactgacaaccagcgtatcctcgagttctttggcctc
aagaaggaggaatgccccgccgtgcgcctcattaccctggaggaggagatgaccaagtac
aagcccgagtcggacgagctgacggcagagaagatcgaggagttctgccaccgcttcctg
gagggcaagatcaagccacacctcatgagccaggagctgcctgaagactgggacaagcag
cctgtcaaggtgctggtcgggaaaaactttgaagaagttgcctttgacgagaaaaagaac
gtctttgtggaattctatgccccgtggtgtgggcactgcaaacagctggctcccatttgg
gataagttgggagagacgtacaaggaccatgaaaacatcgtcatcgccaagatggactcg
acggccaacgaggtggaggccgtgaaagtgcacagcttccccacgctgaagttcttccca
gccagtgcggacaggacggtcattgattacaacggggaacggacattagacggttttaag
aaattcttggagagcggtggccaggacggggccggggacgatgacgatctggaagatctg
gaagaagcggaagagcctgacctggaggaggaggacggtcagagagctgcgagagatgag
ctgtga

DBGET integrated database retrieval system