KEGG   Ailuropoda melanoleuca (giant panda): 100470997Help
Entry
100470997         CDS       T01329                                 

Gene name
P4HB
Definition
(RefSeq) prolyl 4-hydroxylase subunit beta
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100470997 (P4HB)
Enzymes [BR:aml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100470997 (P4HB)
Chaperones and folding catalysts [BR:aml03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100470997 (P4HB)
Membrane trafficking [BR:aml04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100470997 (P4HB)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100470997 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100470997 (P4HB)
  Exosomal proteins of bladder cancer cells
   100470997 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 ERp29_N Thioredoxin_8 AhpC-TSA Redoxin HyaE Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 100470997
NCBI-ProteinID: XP_011223006
Ensembl: ENSAMEG00000017476
Position
Un
AA seq 489 aa AA seqDB search
PEEEDHVLVLHKGNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRL
AKVDATEESDLAQQYGVRGYPTIKFFKNGDTAAPREYTAGREAEDIVNWLKKRTGPAATT
LSDGAAAEALLESSEVTVIGFFKDVESDFAKQFLLAAEAIDDIPFGITSNSDVFSKYQLD
KDGVVLFKKFDEGRNNFEGDVTKDKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILL
FLPKSVSDYDGKLSNFKKAAERFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLIT
LEEEMTKYKPESDELTAEKIEEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEE
VAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHS
FPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDLEEED
GQRAARDEL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ccggaggaggaggaccacgtcttggtgctccacaagggcaacttcgaggaggcgctggcg
gcccacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggctctg
gcccccgagtacgccaaagccgctgggaaactgaaggcggagggttcggagatcaggctg
gcaaaggtcgatgccacggaagagtccgacctagcccagcagtacggtgttcgtggctac
cctacgatcaagttcttcaagaatggagacacagctgctcccagggagtacacagctggc
agagaagctgaggacatcgtgaactggctgaagaagcgcacaggccctgctgccaccacg
ctgtccgacggggccgccgcggaggccttgctggagtccagcgaggtgaccgtcattggc
ttcttcaaggacgtggagtcggactttgccaagcagttcttgctggcagcagaggccatt
gatgacataccttttgggatcacatccaacagtgatgtgttctccaaataccagctggac
aaggacggggttgtgctcttcaagaagtttgacgaaggccgcaacaatttcgagggggac
gtcaccaaggacaagttgttggacttcatcaagcacaaccagctgccgctggtcatcgag
ttcacggagcagacagccccaaagatcttcggaggtgaaatcaagacccacatcctgctg
ttcctgcccaagagcgtgtctgactacgacggcaaactgagcaacttcaagaaggccgct
gagcgcttcaaggggaagatcctgttcatcttcatcgacagtgaccacactgacaaccag
cgtatcctcgagttctttggcctcaagaaggaggaatgccccgccgtgcgcctcattacc
ctggaggaggagatgaccaagtacaagcccgagtcggacgagctgacggcagagaagatc
gaggagttctgccaccgcttcctggagggcaagatcaagccacacctcatgagccaggag
ctgcctgaagactgggacaagcagcctgtcaaggtgctggtcgggaaaaactttgaagaa
gttgcctttgacgagaaaaagaacgtctttgtggaattctatgccccgtggtgtgggcac
tgcaaacagctggctcccatttgggataagttgggagagacgtacaaggaccatgaaaac
atcgtcatcgccaagatggactcgacggccaacgaggtggaggccgtgaaagtgcacagc
ttccccacgctgaagttcttcccagccagtgcggacaggacggtcattgattacaacggg
gaacggacattagacggttttaagaaattcttggagagcggtggccaggacggggccggg
gacgatgacgatctggaagatctggaagaagcggaagagcctgacctggaggaggaggac
ggtcagagagctgcgagagatgagctgtga

DBGET integrated database retrieval system