KEGG   Ailuropoda melanoleuca (giant panda): 100471008Help
Entry
100471008         CDS       T01329                                 

Gene name
RAE1
Definition
(RefSeq) ribonucleic acid export 1
  KO
K14298  
mRNA export factor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100471008 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100471008 (RAE1)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100471008 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTSGTSMFGSTSTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTVHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttggaacaacctcgggttttggaactagtgggaccagcatgtttggcagc
acaagcacagataaccacaaccctatgaaggatattgaagtaacatcctctcccgatgac
agcattggttgtctatctttcagcccaccaaccttgcctgggaactttcttattgcagga
tcctgggctaacgatgttcgctgctgggaagttcaagatagtggacagacgattccaaaa
gcccagcagatgcacacggggcctgtgttagatgtctgctggagtgatgatgggagcaaa
gtatttacagcgtcatgtgataaaactgccaaaatgtgggacctcaacagtaatcaagca
atacagatagcacagcacgatgctcctgtgaaaaccgtacattggatcaaagcaccaaac
tacagctgtgtgatgactgggagttgggataagactctgaagttttgggatacacgatca
tcaaatcctatgatggttttgcagctgcctgaaagatgttactgtgctgatgtgatctac
cctatggccgtggtggcaactgcagagagaggactgattgtctaccagttagagaatcaa
ccttctgagttcaggaggatagaatctccactgaaacatcagcatcgatgtgtggctatt
tttaaagacaaacagaacaagccgactggctttgccctgggaagcattgagggcagggtt
gctattcactacatcaaccccccaaatcctgccaaagataactttaccttcaaatgtcac
cgctcgaacggaaccaatacctcagctcctcaggacatctatgcggtaaacgggatcgct
ttccatcctgtccatggcacccttgcaactgtgggttctgatggtagattcagcttttgg
gacaaagatgccagaacgaaactaaaaacttcagaacagttagatcaaccgatatcggct
tgctgcttcaatcacaatggaaatatatttgcctacgcttccagctacgactggtcaaag
ggacatgaattttataatccccaaaagaaaaattacattttcctgcgtaatgcagccgaa
gagctaaaacccaggaataagaagtag

DBGET integrated database retrieval system