KEGG   Ailuropoda melanoleuca (giant panda): 100471021Help
Entry
100471021         CDS       T01329                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100471021 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100471021 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100471021 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100471021 (PLCD3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100471021 (PLCD3)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100471021 (PLCD3)
Membrane trafficking [BR:aml04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100471021 (PLCD3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100471021 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 743 aa AA seqDB search
MVCPGCLLQGLTEDEDVRAMLRGSRLCKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPS
QHICEPGRTGAEAVREGHQSEGLRRFGGAFPPARCLTIAFKGRRKNLDRAAATADEAQCW
VRGLAKLRARLDAMSQRERLDHWIHAYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYA
YRLFKECDHSNNERLEGAEIEEFLRRLLKRPELEEIFHRYSGEDRVLSAPELLEFLEDQG
EDGVMLAHAQKLIHTYELNETAKQHDLMTLDGFMMYLLSPEGAALDPAHTCVFQDMDQPL
PHYFISSSHNTYLTDSQIGGLSSTEAYVRAFAQGCRCVELDCWEGPGGEPIIYHGHTLTS
KILFRDVIQTVRDHAFTLSPYPVILSLENHCGLEQQAVMARHLRTILGDALVTEALGAQT
PEELPSPEQLKGRVLVKGKKLPAAWSEDGRILSDQEEEEEEEEGEAEAAEQRRRAKQISP
ELSALVVYCCATRLRTLHPNPVPPQPCQVSSLNERKAKKLIREAGNSFVRHNARQLTRVY
PLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLVNGQCGYILKPACLRQP
DTTFDPECPGPPRTTLTIQVLTAQQLPKLNTEKPNSIVDPLVRVEIHGVPADCARKETNY
VLNNGFNPRWGQTLQFQLRAPELVLVRFVVEDYDTTSPNDFVGQFTLPLNSLKQGYRHIH
LLSKDGASLSPATLFVHIRVQRF
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggtctgcccaggatgtctcctgcagggcctgacggaggacgaggacgtgcgcgccatg
ctgcggggctcccggctctgcaagatccgctcgcggacgtggcacaaggagcggctgtac
cggctgcaggaggacggcctgagcgtgtggttccagcggcgcatcccgcgcgcgccgtcg
cagcacatctgtgagccggggcgcacgggcgcggaggccgtccgcgagggccaccagtcc
gagggcctgcggcgcttcgggggcgccttcccgccggcgcgctgcctcaccatcgccttc
aagggccgccgcaagaacttggaccgggcggccgccacggcggatgaggcgcagtgctgg
gtgcgcggcctcgccaagctgcgcgcgcgcctcgacgccatgagccagcgcgagcgcctc
gaccactggatccacgcctacctgcaccgcgcggactcggaccaggacagtaagatgagc
ttcaaggagatcaagagcctgctcaggatggtcaacgtggacatgaacgacatgtacgcc
taccgcctcttcaaggagtgcgaccactccaacaatgagcggctggagggggctgagatc
gaggagtttctgcggcggttgctgaaacgccccgagctggaggagatattccatcggtac
tccggcgaggaccgtgtgctgagcgccccggagctgctggagttcctagaggaccagggc
gaggacggggtcatgctggcccacgcccagaagctcatccacacctatgagctcaacgag
acagccaagcagcatgacctgatgacactggatggcttcatgatgtacctgttgtcaccc
gaaggggctgccctggacccggcccacacatgcgtgttccaggacatggaccagcccctc
ccccactacttcatctcctcctcacacaacacctatctgactgactctcagatcgggggg
ctcagcagcaccgaggcctatgtcagggcctttgcccagggatgccgctgtgtggagctg
gactgctgggaggggccaggaggggagcccatcatctatcacggccacactctcacctct
aagatcctcttccgagatgtgatccagaccgtgcgcgaccacgccttcactctgtcccca
taccctgtcatcctgtccctcgagaaccactgtgggctggagcagcaggctgtcatggcc
cgccaccttcgcaccatcctgggggacgcactggtgacagaagcgctgggcgcccagacc
cctgaagagttgccatccccggagcagctgaagggccgggtcctggtgaaggggaagaag
ctgccagctgcttggagcgaggatggtcgaattctgtccgaccaggaggaggaagaggaa
gaggaagaaggggaggcagaggccgcagaacagaggcggcgggccaagcagatctccccc
gagctgtcggccctggtcgtgtactgctgtgccacccgcctgcggaccctgcaccccaac
ccggtgccgccccagccctgccaggtcagctccctcaacgagcgcaaggccaagaagctc
atccgagaggcagggaacagctttgtcaggcacaatgcccgtcaactgacccgcgtctac
cctctggggctgcggatgaactcggccaactacagcccccaggagatgtggaactcaggc
tgtcagctggtggccttgaacttccagacaccaggctacgagatggacctcaatgccggg
cgctttctcgtcaacgggcagtgcggctacatcctgaaacccgcctgcctgcggcagccc
gacacaacttttgaccctgagtgccctgggccccccagaacgactctcaccatccaggtg
ctgacggcacagcagctgcccaagctgaacactgagaagccgaactccatcgtggacccc
ctggtgcgtgtagagatccatggggtgcccgcagactgtgctcgaaaggagaccaactat
gtgctcaacaacggcttcaacccccgctgggggcagaccctgcagttccagctgcgggct
ccggagctggtgctggtccgcttcgtggtggaagattatgacaccacctcccccaatgac
tttgtgggccagtttacgctgcctctcaacagcctgaagcaaggttaccgccacatccac
ctgctttccaaggacggggcctcactgtcgccagccacgctcttcgtccacatccgtgtc
cagcgcttctga

DBGET integrated database retrieval system