KEGG   Ailuropoda melanoleuca (giant panda): 100471021Help
Entry
100471021         CDS       T01329                                 

Gene name
PLCD3
Definition
(RefSeq) phospholipase C, delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100471021 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100471021 (PLCD3)
   04070 Phosphatidylinositol signaling system
    100471021 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100471021 (PLCD3)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100471021 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 779 aa AA seqDB search
MRWTQRGHLDISPRQALAGLVLESLACDPGAREASAVLPCLGESRGLTEDEDVRAMLRGS
RLCKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHICEPGRTGAEAVREGHQSEGLR
RFGGAFPPARCLTIAFKGRRKNLDRAAATADEAQCWVRGLAKLRARLDAMSQRERLDHWI
HAYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYAYRLFKECDHSNNERLEGAEIEEFL
RRLLKRPELEEIFHRYSGEDRVLSAPELLEFLEDQGEDGVMLAHAQKLIHTYELNETAKQ
HDLMTLDGFMMYLLSPEGAALDPAHTCVFQDMDQPLPHYFISSSHNTYLTDSQIGGLSST
EAYVRAFAQGCRCVELDCWEGPGGEPIIYHGHTLTSKILFRDVIQTVRDHAFTLSPYPVI
LSLENHCGLEQQAVMARHLRTILGDALVTEALGAQTPEELPSPEQLKGRVLVKGKKLPAA
WSEDGRILSDQEEEEEEEEGEAEAAEQRRRAKQISPELSALVVYCCATRLRTLHPNPVPP
QPCQVSSLNERKAKKLIREAGNSFVRHNARQLTRVYPLGLRMNSANYSPQEMWNSGCQLV
ALNFQTPGYEMDLNAGRFLVNGQCGYILKPACLRQPDTTFDPECPGPPRTTLTIQVLTAQ
QLPKLNTEKPNSIVDPLVRVEIHGVPADCARKETNYVLNNGFNPRWGQTLQFQLRAPELV
LVRFVVEDYDTTSPNDFVGQFTLPLNSLKQGYRHIHLLSKDGASLSPATLFVHIRVQRF
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggacacaaagaggacatctggatatcagccccaggcaggctttggcagggctg
gtcctggaatccttggcctgtgaccctggagccagagaggcctctgctgtcctcccttgt
cttggagaaagcagaggcctgacggaggacgaggacgtgcgcgccatgctgcggggctcc
cggctctgcaagatccgctcgcggacgtggcacaaggagcggctgtaccggctgcaggag
gacggcctgagcgtgtggttccagcggcgcatcccgcgcgcgccgtcgcagcacatctgt
gagccggggcgcacgggcgcggaggccgtccgcgagggccaccagtccgagggcctgcgg
cgcttcgggggcgccttcccgccggcgcgctgcctcaccatcgccttcaagggccgccgc
aagaacttggaccgggcggccgccacggcggatgaggcgcagtgctgggtgcgcggcctc
gccaagctgcgcgcgcgcctcgacgccatgagccagcgcgagcgcctcgaccactggatc
cacgcctacctgcaccgcgcggactcggaccaggacagtaagatgagcttcaaggagatc
aagagcctgctcaggatggtcaacgtggacatgaacgacatgtacgcctaccgcctcttc
aaggagtgcgaccactccaacaatgagcggctggagggggctgagatcgaggagtttctg
cggcggttgctgaaacgccccgagctggaggagatattccatcggtactccggcgaggac
cgtgtgctgagcgccccggagctgctggagttcctagaggaccagggcgaggacggggtc
atgctggcccacgcccagaagctcatccacacctatgagctcaacgagacagccaagcag
catgacctgatgacactggatggcttcatgatgtacctgttgtcacccgaaggggctgcc
ctggacccggcccacacatgcgtgttccaggacatggaccagcccctcccccactacttc
atctcctcctcacacaacacctatctgactgactctcagatcggggggctcagcagcacc
gaggcctatgtcagggcctttgcccagggatgccgctgtgtggagctggactgctgggag
gggccaggaggggagcccatcatctatcacggccacactctcacctctaagatcctcttc
cgagatgtgatccagaccgtgcgcgaccacgccttcactctgtccccataccctgtcatc
ctgtccctcgagaaccactgtgggctggagcagcaggctgtcatggcccgccaccttcgc
accatcctgggggacgcactggtgacagaagcgctgggcgcccagacccctgaagagttg
ccatccccggagcagctgaagggccgggtcctggtgaaggggaagaagctgccagctgct
tggagcgaggatggtcgaattctgtccgaccaggaggaggaagaggaagaggaagaaggg
gaggcagaggccgcagaacagaggcggcgggccaagcagatctcccccgagctgtcggcc
ctggtcgtgtactgctgtgccacccgcctgcggaccctgcaccccaacccggtgccgccc
cagccctgccaggtcagctccctcaacgagcgcaaggccaagaagctcatccgagaggca
gggaacagctttgtcaggcacaatgcccgtcaactgacccgcgtctaccctctggggctg
cggatgaactcggccaactacagcccccaggagatgtggaactcaggctgtcagctggtg
gccttgaacttccagacaccaggctacgagatggacctcaatgccgggcgctttctcgtc
aacgggcagtgcggctacatcctgaaacccgcctgcctgcggcagcccgacacaactttt
gaccctgagtgccctgggccccccagaacgactctcaccatccaggtgctgacggcacag
cagctgcccaagctgaacactgagaagccgaactccatcgtggaccccctggtgcgtgta
gagatccatggggtgcccgcagactgtgctcgaaaggagaccaactatgtgctcaacaac
ggcttcaacccccgctgggggcagaccctgcagttccagctgcgggctccggagctggtg
ctggtccgcttcgtggtggaagattatgacaccacctcccccaatgactttgtgggccag
tttacgctgcctctcaacagcctgaagcaaggttaccgccacatccacctgctttccaag
gacggggcctcactgtcgccagccacgctcttcgtccacatccgtgtccagcgcttctga

DBGET integrated database retrieval system