KEGG   Ailuropoda melanoleuca (giant panda): 100471037Help
Entry
100471037         CDS       T01329                                 

Gene name
ALOX12
Definition
arachidonate 12-lipoxygenase
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aml00590]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:aml04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:aml04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 630 aa AA seqDB search
MAAKCRGLWSPQEEEFERDVPKDLGPLQFVKLRKHHSLVDDAWFCDLITVRGPGACEEAA
FPCYRWVQGQGVLSLPEGTARLAGDNALDVFQKHREKELKERQKLYCWDTWKEGLPLTIA
AGCQDDLPPNMRFHEDKRLDFEWALKAGALEMVLKRVYTLLSSWNRLEDFDQIFWGQKSA
LAEKVHQCWQDDELFGYQFLNGANPMLLRRSTSLPSRLALPPEMEALGAQLERELQNRSL
FEADFILLDGIPTNVIRGEKQYLAAPLVLLKMTPNGKLLPLVIQIQPPSPSSPTPPLFLP
SDPPFAWLLAKAWVRNSDFQLHQLQYHLLNTHLVAEVIAVATMRRLPGLHPVFKLLIPHT
RYTMEINTRARSQLIAEGGIFDQAVSTGGGGHVHLLRRAMAQLTYCSLCPPDDLADRGLL
GIPGALYAHDALRLWGIIARYVEGIVHVFYHRDDVVRGDPELQAWCREITEVGLCQAQDR
GFPVSFQSQKQLCHFLTMCVFTCTAQHGAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVT
MATVMGSLPDVRQACLQMTITWHLGRRQPDMVPLGHHKEKYFSSPKAKAVLNQFRTDLEN
LEREITARNEQLDLPYDYLKPSRIENSVTI
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaagtgtcgcgggctgtggtccccacaggaggaggagtttgagcgcgacgtc
cccaaggacttggggcccctgcagttcgtgaagttgcgcaaacaccactccctggtggac
gacgcgtggttctgcgacctcatcaccgtgcgcggcccgggagcctgcgaggaggccgcc
ttcccctgctaccgctgggtgcagggccagggcgtgctgagcctgcccgagggcaccgca
cgcctggcaggagacaatgccctggacgtgttccagaagcatcgagagaaagaactgaag
gaaagacaaaagctgtactgctgggacacctggaaggaggggttacccctgaccatagct
gccgggtgtcaggacgatctacctccaaacatgagattccacgaggacaagaggctggac
ttcgagtgggcactgaaggcgggggcgctggagatggtcctcaaacgtgtctacaccctc
ctgagctcctggaaccgcctggaggattttgatcagatcttctggggccagaagagcgcc
ctggctgagaaggtccaccagtgctggcaggacgatgagctttttggctaccagttcctc
aatggcgccaaccccatgctgttgagacgctccacctccctgccctcccggctcgcgctg
cccccggagatggaggcactgggggcccagctggagagagagctccagaaccgttccctg
tttgaggctgatttcatcctgctggatgggattcccaccaatgtgatccggggcgagaag
cagtacctggccgcccccctcgtcctgctgaagatgacgcccaacgggaagctgctgccc
ctggtcatccagatccagcctcccagccccagctcccccaccccgccgctgttcctgccc
tcagatcccccattcgcctggctcctggcaaaggcctgggtccgaaattccgatttccag
ctgcaccagctccagtatcacctgctgaacactcacctggtggccgaggtcatcgctgtg
gccaccatgaggcgcctcccggggctgcaccctgtcttcaagctcctgatcccacacacc
cgctacaccatggagatcaacacccgggccagatcgcagctcatcgcagaaggaggaata
tttgaccaggcggtgagcacgggcggagggggccacgtgcacttgctgcgtcgggccatg
gctcagctgacctactgctccctctgtcctcctgacgacctggctgaccggggcctgctg
ggaatcccaggtgccctctacgcccacgacgctttacggctttgggggatcatcgcccgg
tacgtggagggcattgtccacgtcttctaccacagggatgacgtcgtgagaggggacccg
gagctgcaggcctggtgtcgggagatcactgaggtggggctgtgccaggcccaggaccga
ggttttcccgtatccttccagtcccagaagcagctctgccatttccttaccatgtgtgtc
ttcacatgcactgctcagcacggggccatcaaccagggccagctggattggtatgcctgg
gttcctaatgccccatgcacaatgaggatgcccccacccaccaccaaggaagatgtaaca
atggccacagtgatgggctcactacctgatgtccgtcaggcctgtcttcaaatgaccatc
acgtggcatctgggtcgccgccagccagacatggtgcctctggggcatcacaaagaaaag
tatttctcaagccccaaggccaaggctgtattaaaccaattccgaacggatttggaaaac
ctagaaagagagattacagcccggaatgagcaactcgatctgccctatgactacctgaag
cccagccgcatagagaacagcgtcactatctga

DBGET integrated database retrieval system