KEGG   Ailuropoda melanoleuca (giant panda): 100471037Help
Entry
100471037         CDS       T01329                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100471037 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100471037 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100471037 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    100471037 (ALOX12)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     100471037 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 630 aa AA seqDB search
MAAKCRGLWSPQEEEFERDVPKDLGPLQFVKLRKHHSLVDDAWFCDLITVRGPGACEEAA
FPCYRWVQGQGVLSLPEGTARLAGDNALDVFQKHREKELKERQKLYCWDTWKEGLPLTIA
AGCQDDLPPNMRFHEDKRLDFEWALKAGALEMVLKRVYTLLSSWNRLEDFDQIFWGQKSA
LAEKVHQCWQDDELFGYQFLNGANPMLLRRSTSLPSRLALPPEMEALGAQLERELQNRSL
FEADFILLDGIPTNVIRGEKQYLAAPLVLLKMTPNGKLLPLVIQIQPPSPSSPTPPLFLP
SDPPFAWLLAKAWVRNSDFQLHQLQYHLLNTHLVAEVIAVATMRRLPGLHPVFKLLIPHT
RYTMEINTRARSQLIAEGGIFDQAVSTGGGGHVHLLRRAMAQLTYCSLCPPDDLADRGLL
GIPGALYAHDALRLWGIIARYVEGIVHVFYHRDDVVRGDPELQAWCREITEVGLCQAQDR
GFPVSFQSQKQLCHFLTMCVFTCTAQHGAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVT
MATVMGSLPDVRQACLQMTITWHLGRRQPDMVPLGHHKEKYFSSPKAKAVLNQFRTDLEN
LEREITARNEQLDLPYDYLKPSRIENSVTI
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaagtgtcgcgggctgtggtccccacaggaggaggagtttgagcgcgacgtc
cccaaggacttggggcccctgcagttcgtgaagttgcgcaaacaccactccctggtggac
gacgcgtggttctgcgacctcatcaccgtgcgcggcccgggagcctgcgaggaggccgcc
ttcccctgctaccgctgggtgcagggccagggcgtgctgagcctgcccgagggcaccgca
cgcctggcaggagacaatgccctggacgtgttccagaagcatcgagagaaagaactgaag
gaaagacaaaagctgtactgctgggacacctggaaggaggggttacccctgaccatagct
gccgggtgtcaggacgatctacctccaaacatgagattccacgaggacaagaggctggac
ttcgagtgggcactgaaggcgggggcgctggagatggtcctcaaacgtgtctacaccctc
ctgagctcctggaaccgcctggaggattttgatcagatcttctggggccagaagagcgcc
ctggctgagaaggtccaccagtgctggcaggacgatgagctttttggctaccagttcctc
aatggcgccaaccccatgctgttgagacgctccacctccctgccctcccggctcgcgctg
cccccggagatggaggcactgggggcccagctggagagagagctccagaaccgttccctg
tttgaggctgatttcatcctgctggatgggattcccaccaatgtgatccggggcgagaag
cagtacctggccgcccccctcgtcctgctgaagatgacgcccaacgggaagctgctgccc
ctggtcatccagatccagcctcccagccccagctcccccaccccgccgctgttcctgccc
tcagatcccccattcgcctggctcctggcaaaggcctgggtccgaaattccgatttccag
ctgcaccagctccagtatcacctgctgaacactcacctggtggccgaggtcatcgctgtg
gccaccatgaggcgcctcccggggctgcaccctgtcttcaagctcctgatcccacacacc
cgctacaccatggagatcaacacccgggccagatcgcagctcatcgcagaaggaggaata
tttgaccaggcggtgagcacgggcggagggggccacgtgcacttgctgcgtcgggccatg
gctcagctgacctactgctccctctgtcctcctgacgacctggctgaccggggcctgctg
ggaatcccaggtgccctctacgcccacgacgctttacggctttgggggatcatcgcccgg
tacgtggagggcattgtccacgtcttctaccacagggatgacgtcgtgagaggggacccg
gagctgcaggcctggtgtcgggagatcactgaggtggggctgtgccaggcccaggaccga
ggttttcccgtatccttccagtcccagaagcagctctgccatttccttaccatgtgtgtc
ttcacatgcactgctcagcacggggccatcaaccagggccagctggattggtatgcctgg
gttcctaatgccccatgcacaatgaggatgcccccacccaccaccaaggaagatgtaaca
atggccacagtgatgggctcactacctgatgtccgtcaggcctgtcttcaaatgaccatc
acgtggcatctgggtcgccgccagccagacatggtgcctctggggcatcacaaagaaaag
tatttctcaagccccaaggccaaggctgtattaaaccaattccgaacggatttggaaaac
ctagaaagagagattacagcccggaatgagcaactcgatctgccctatgactacctgaag
cccagccgcatagagaacagcgtcactatctga

DBGET integrated database retrieval system