KEGG   Ailuropoda melanoleuca (giant panda): 100471086Help
Entry
100471086         CDS       T01329                                 

Gene name
AOX3L1
Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100471086 (AOX3L1)
   00350 Tyrosine metabolism
    100471086 (AOX3L1)
   00380 Tryptophan metabolism
    100471086 (AOX3L1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100471086 (AOX3L1)
   00760 Nicotinate and nicotinamide metabolism
    100471086 (AOX3L1)
   00830 Retinol metabolism
    100471086 (AOX3L1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100471086 (AOX3L1)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100471086 (AOX3L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1343 aa AA seqDB search
MPCPSKSDDLVFFVNGRKVIERNVDPEVTLLTFLRKNLRLTGTKYACGSGGCGACTVMVS
KRDPLSANIRHFSITACLVPICSLYGAAVTTVEGVGSINTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLLEALGGNLCRCTGYRPILASGRTFCVESNGCQQKGTG
KCCLDPRGNDSSSLLRESDICTELFAEDEFQPLDPTQELIFPPELLRMAEKPEKQTLIFR
GERVAWISPGTLKDLLELKAKHPEAPLISGNTSLGPAVKSQGHFHPILLSPARISELSMV
SKTSDGLTIGAGCSLAQVKDILAERVSELPEEKTQTYRALLKHLRSLASQQIRNMASLGG
HIISRHCYSDLNPILAVGNATLNLISEEGTRQIPLNEHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALADVNAGMRVILKEGTDTIKDLSIAYGGVGAATVSAQKSC
QQLVGRPWNELMLEEACRLLLEEVSLPGWAPGGKVEFKRTLVVSFFFKFYLEVLQELKKL
VKLMPDSHHYPEISDQFLSALEDFPITGPQGVQRYQRVGSHQSLQDPVGRPIMHLSGLKH
ATGEAIFCDDIPMVDRELFMVLVTSTRAHAKIISVDLSEALDLPGVIDVITAEDIPGTNG
SEDDKLMAVDEVLCVGHIICAVVAETEVQAKSATEKIKITYEDLEPVIFTINDAIKHNSF
LCPEKKLEQGNVEEAFEKVDQIVEGEVHVGGQEHFYMETQRVLVIPKAEDKELDIYVSTQ
DPAHVQKTVSSTLNIPINRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAIKTGHPIRLVL
DRKDDMLITGGRHPLFGKYKVGFMNNGRIKALDIECFVNGGCMLDDSELVTESLILKLEN
AYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGTLITESCITAVAAKCGLLPEKIREKNMY
KTVDKTIYKQAFSPETLIRCWNECLDKSSFHSRRMQVEEFNKKNYWKKKGMAIIPMKFSV
GFAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELNIPMSSLHICETS
TATVPNTIATAASIGSDVNGRAVQNACQILLKRLEPIIKKNPEGTWEDWIESAFEQRISL
SATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCSLN
PAIDIGQVEGSFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTITDVPEEFNVSLLPSS
QTPPTIYSSKGLGESGMFLGSSVFFAITDAVATARRERDTVEDFTVRSPATPERVRMACA
DRFTEMIPRDDPKTFRPWSIPIA
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcccatcgaaatcggatgacttggttttctttgtgaatgggagaaaggtgata
gagaggaatgtggacccagaagtcacactgctgaccttcctacgaaagaacttacgcctc
acaggaaccaagtacgcctgtggaagtggaggctgtggtgcgtgcacggtgatggtgtct
aagcgtgacccgctgtctgcgaacataagacacttctccattactgcatgcctggtgccc
atctgctctctgtatggggctgctgtcaccaccgtggaaggtgttggaagtatcaacacc
aggcttcaccctgtgcaggagaggatcgccaagagccatggcacccagtgtgggttctgc
acccctgggatggtgatgtccatgtacacgctgcttaggaaccacccgcagccctcggag
gagcagctcctggaagccctgggaggtaatctatgccgctgcaccgggtatcggccaatt
ctcgcaagcggaaggaccttctgtgtggagtcaaatggctgtcaacagaaaggaacagga
aaatgctgcttggatcccagaggaaatgattcttcttcactcctcagggaaagtgacatt
tgcacagagttatttgcggaagacgagttccagcccttggaccctacccaggagcttata
tttcccccagaactcctgagaatggcagagaagccagaaaaacaaaccctgatttttcgt
ggagagagggttgcttggatctcccctggcaccctcaaggatctcctggagctgaaagcc
aaacatcctgaagcccctctcatctcgggcaacacctcactgggtcctgcagtgaaatct
caaggacattttcacccaattctcctctctcctgctaggatttctgagctcagtatggta
tccaaaacaagtgatggactgacaataggtgctggctgcagtctggcccaagtgaaagac
attttggctgagcgagtttccgagcttccagaggagaaaactcagacataccgagccctc
ctgaagcacctgaggagtctggcgagccagcagatccggaatatggcatccttaggggga
catattataagccggcactgctattcggatctgaatccaattttggctgtgggcaacgct
accctcaatctgatatcagaagaaggtacacggcagattcctctaaacgaacattttctt
gccgggttggcaagtgcagacctaaagccagaggaaattttggaatctgtgtacatccct
cactctcaaaagtgggaatttgtgtcagccttccgacaggctcagtgccaacaaaatgcc
ttggccgatgtgaacgctggcatgcgagtcatcctcaaggaaggcacagacaccatcaag
gacctgagcatcgcttacggaggggttggggccgccacggtcagtgcacagaaatcctgc
cagcagctcgtggggaggccctggaatgagctgatgctggaggaagcttgcaggctgctt
ctggaagaagtctccctcccaggctgggctccaggggggaaagtggaattcaagaggact
ctggtggtcagtttcttcttcaaattctacctagaagttctgcaggaactgaagaagctg
gtaaagcttatgcctgacagccatcattatcctgaaatttcagaccaattcctaagtgct
ctagaagacttccccatcacaggaccccagggagtccaaaggtaccagcgtgtgggttct
caccagtccctccaagatccagttggacgccccatcatgcacctatcaggtcttaaacat
gctacaggtgaagccatattttgtgatgacattccaatggtggatagagaacttttcatg
gttttggtgaccagtaccagagcccatgcaaaaattatatcagttgatttgtctgaggcc
cttgacctaccaggggtgattgatgtgataacagctgaggacattccaggcaccaatggg
tctgaggatgacaaattgatggctgtagatgaggtgctttgcgtgggccacatcatctgt
gctgtggttgcagagacagaagtacaggcaaagagtgcaactgaaaagataaagatcacc
tatgaagatctggagccagtaatcttcaccatcaacgatgccataaagcacaactcattc
ctatgccctgaaaaaaaacttgaacaaggaaacgttgaggaggcatttgaaaaagtcgat
caaattgttgaaggagaggtccacgttggaggacaggaacatttttacatggaaacacaa
agagtgcttgttattccgaaggcagaggacaaggaactggacatttatgtgtcaacacag
gatccagcccacgtacagaaaacagtgtcctctactttaaacatccccatcaacaggatc
acctgccatgtcaaacgggtgggtggaggttttggtgggaaagtaggaagaccagctgta
tttggagctattgcagctgtgggcgctatcaaaactggtcatcccattcgtcttgttctt
gatcgcaaagatgatatgttaataactgggggaagacacccattatttggaaaatataaa
gtgggattcatgaacaatgggcgaatcaaagctctggacatcgagtgctttgtcaacgga
ggatgcatgctggatgactctgagctggtaacagaatctcttatattaaagctagaaaat
gcatataaaatccgcaacctcaggttccggggccgtgcatgcatgacaaatctaccatct
aacacagcctttcgcggatttggcttcccacaaggaaccctgataacagaatcttgcatc
acagctgtggcagccaaatgtggccttctgccagaaaagattagggagaaaaacatgtac
aaaacggttgataaaaccatctacaaacaagcgttcagccctgagaccctgataagatgt
tggaatgagtgtctggacaagtcttcctttcacagcagaagaatgcaagtggaagagttt
aacaagaagaattattggaagaagaaaggcatggcaatcatccccatgaagttctcagtc
ggctttgctgcaacaagctatcaccaggcagctgccctcgttcatatctacacagatggc
tctgtattggtcacacatggaggcaacgaactgggacaaggtattcacaccaaaatgctg
caggttgccagccgtgaattaaacatacccatgtcttctctgcacatctgtgaaacaagt
acggccacagtgcctaatacaattgccacggcagcttccattggttcggatgtcaacggc
agagccgttcagaatgcttgtcagatccttctgaaacgcctcgagcccatcattaagaaa
aatccagaaggtacatgggaagactggatagaatctgctttcgaacaaagaatcagtctt
tcagccactggatacttcaggggctacaaggccttcatggactgggagaagggagaagga
gacccttttccatactatgtctatggagcagcctgttcagaggttgaaattgactgcctg
acgggagctcacaagaaaatcagaacagacattgtcatggatgcatgttgcagcctaaat
cccgctattgatattgggcaggttgaaggttcctttattcagggaatgggcctttatacc
actgaagagctgaaatattccccagaaggtgttctgtactctcgaggcccagacgagtac
aaaattccaaccatcactgacgtcccagaggagttcaatgtctccctgttgccatcctca
caaaccccaccaaccatctattcatccaagggcctgggagagtctgggatgttcttgggc
tcgtctgtgttctttgccatcactgatgctgtggccacagcacgcagggaaagagacaca
gtggaggacttcacagtgaggagcccagcaacgccagaacgggttcgaatggcctgtgca
gatcgtttcacagagatgatcccaagagatgacccgaagacatttagaccttggtctatc
cctatagcataa

DBGET integrated database retrieval system