KEGG   Ailuropoda melanoleuca (giant panda): 100471086Help
Entry
100471086         CDS       T01329                                 

Gene name
AOX3L1
Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:aml00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:aml00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:aml00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:aml00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:aml00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:aml00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:aml00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1343 aa AA seqDB search
MPCPSKSDDLVFFVNGRKVIERNVDPEVTLLTFLRKNLRLTGTKYACGSGGCGACTVMVS
KRDPLSANIRHFSITACLVPICSLYGAAVTTVEGVGSINTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLLEALGGNLCRCTGYRPILASGRTFCVESNGCQQKGTG
KCCLDPRGNDSSSLLRESDICTELFAEDEFQPLDPTQELIFPPELLRMAEKPEKQTLIFR
GERVAWISPGTLKDLLELKAKHPEAPLISGNTSLGPAVKSQGHFHPILLSPARISELSMV
SKTSDGLTIGAGCSLAQVKDILAERVSELPEEKTQTYRALLKHLRSLASQQIRNMASLGG
HIISRHCYSDLNPILAVGNATLNLISEEGTRQIPLNEHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALADVNAGMRVILKEGTDTIKDLSIAYGGVGAATVSAQKSC
QQLVGRPWNELMLEEACRLLLEEVSLPGWAPGGKVEFKRTLVVSFFFKFYLEVLQELKKL
VKLMPDSHHYPEISDQFLSALEDFPITGPQGVQRYQRVGSHQSLQDPVGRPIMHLSGLKH
ATGEAIFCDDIPMVDRELFMVLVTSTRAHAKIISVDLSEALDLPGVIDVITAEDIPGTNG
SEDDKLMAVDEVLCVGHIICAVVAETEVQAKSATEKIKITYEDLEPVIFTINDAIKHNSF
LCPEKKLEQGNVEEAFEKVDQIVEGEVHVGGQEHFYMETQRVLVIPKAEDKELDIYVSTQ
DPAHVQKTVSSTLNIPINRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAIKTGHPIRLVL
DRKDDMLITGGRHPLFGKYKVGFMNNGRIKALDIECFVNGGCMLDDSELVTESLILKLEN
AYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGTLITESCITAVAAKCGLLPEKIREKNMY
KTVDKTIYKQAFSPETLIRCWNECLDKSSFHSRRMQVEEFNKKNYWKKKGMAIIPMKFSV
GFAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELNIPMSSLHICETS
TATVPNTIATAASIGSDVNGRAVQNACQILLKRLEPIIKKNPEGTWEDWIESAFEQRISL
SATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCSLN
PAIDIGQVEGSFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTITDVPEEFNVSLLPSS
QTPPTIYSSKGLGESGMFLGSSVFFAITDAVATARRERDTVEDFTVRSPATPERVRMACA
DRFTEMIPRDDPKTFRPWSIPIA
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcccatcgaaatcggatgacttggttttctttgtgaatgggagaaaggtgata
gagaggaatgtggacccagaagtcacactgctgaccttcctacgaaagaacttacgcctc
acaggaaccaagtacgcctgtggaagtggaggctgtggtgcgtgcacggtgatggtgtct
aagcgtgacccgctgtctgcgaacataagacacttctccattactgcatgcctggtgccc
atctgctctctgtatggggctgctgtcaccaccgtggaaggtgttggaagtatcaacacc
aggcttcaccctgtgcaggagaggatcgccaagagccatggcacccagtgtgggttctgc
acccctgggatggtgatgtccatgtacacgctgcttaggaaccacccgcagccctcggag
gagcagctcctggaagccctgggaggtaatctatgccgctgcaccgggtatcggccaatt
ctcgcaagcggaaggaccttctgtgtggagtcaaatggctgtcaacagaaaggaacagga
aaatgctgcttggatcccagaggaaatgattcttcttcactcctcagggaaagtgacatt
tgcacagagttatttgcggaagacgagttccagcccttggaccctacccaggagcttata
tttcccccagaactcctgagaatggcagagaagccagaaaaacaaaccctgatttttcgt
ggagagagggttgcttggatctcccctggcaccctcaaggatctcctggagctgaaagcc
aaacatcctgaagcccctctcatctcgggcaacacctcactgggtcctgcagtgaaatct
caaggacattttcacccaattctcctctctcctgctaggatttctgagctcagtatggta
tccaaaacaagtgatggactgacaataggtgctggctgcagtctggcccaagtgaaagac
attttggctgagcgagtttccgagcttccagaggagaaaactcagacataccgagccctc
ctgaagcacctgaggagtctggcgagccagcagatccggaatatggcatccttaggggga
catattataagccggcactgctattcggatctgaatccaattttggctgtgggcaacgct
accctcaatctgatatcagaagaaggtacacggcagattcctctaaacgaacattttctt
gccgggttggcaagtgcagacctaaagccagaggaaattttggaatctgtgtacatccct
cactctcaaaagtgggaatttgtgtcagccttccgacaggctcagtgccaacaaaatgcc
ttggccgatgtgaacgctggcatgcgagtcatcctcaaggaaggcacagacaccatcaag
gacctgagcatcgcttacggaggggttggggccgccacggtcagtgcacagaaatcctgc
cagcagctcgtggggaggccctggaatgagctgatgctggaggaagcttgcaggctgctt
ctggaagaagtctccctcccaggctgggctccaggggggaaagtggaattcaagaggact
ctggtggtcagtttcttcttcaaattctacctagaagttctgcaggaactgaagaagctg
gtaaagcttatgcctgacagccatcattatcctgaaatttcagaccaattcctaagtgct
ctagaagacttccccatcacaggaccccagggagtccaaaggtaccagcgtgtgggttct
caccagtccctccaagatccagttggacgccccatcatgcacctatcaggtcttaaacat
gctacaggtgaagccatattttgtgatgacattccaatggtggatagagaacttttcatg
gttttggtgaccagtaccagagcccatgcaaaaattatatcagttgatttgtctgaggcc
cttgacctaccaggggtgattgatgtgataacagctgaggacattccaggcaccaatggg
tctgaggatgacaaattgatggctgtagatgaggtgctttgcgtgggccacatcatctgt
gctgtggttgcagagacagaagtacaggcaaagagtgcaactgaaaagataaagatcacc
tatgaagatctggagccagtaatcttcaccatcaacgatgccataaagcacaactcattc
ctatgccctgaaaaaaaacttgaacaaggaaacgttgaggaggcatttgaaaaagtcgat
caaattgttgaaggagaggtccacgttggaggacaggaacatttttacatggaaacacaa
agagtgcttgttattccgaaggcagaggacaaggaactggacatttatgtgtcaacacag
gatccagcccacgtacagaaaacagtgtcctctactttaaacatccccatcaacaggatc
acctgccatgtcaaacgggtgggtggaggttttggtgggaaagtaggaagaccagctgta
tttggagctattgcagctgtgggcgctatcaaaactggtcatcccattcgtcttgttctt
gatcgcaaagatgatatgttaataactgggggaagacacccattatttggaaaatataaa
gtgggattcatgaacaatgggcgaatcaaagctctggacatcgagtgctttgtcaacgga
ggatgcatgctggatgactctgagctggtaacagaatctcttatattaaagctagaaaat
gcatataaaatccgcaacctcaggttccggggccgtgcatgcatgacaaatctaccatct
aacacagcctttcgcggatttggcttcccacaaggaaccctgataacagaatcttgcatc
acagctgtggcagccaaatgtggccttctgccagaaaagattagggagaaaaacatgtac
aaaacggttgataaaaccatctacaaacaagcgttcagccctgagaccctgataagatgt
tggaatgagtgtctggacaagtcttcctttcacagcagaagaatgcaagtggaagagttt
aacaagaagaattattggaagaagaaaggcatggcaatcatccccatgaagttctcagtc
ggctttgctgcaacaagctatcaccaggcagctgccctcgttcatatctacacagatggc
tctgtattggtcacacatggaggcaacgaactgggacaaggtattcacaccaaaatgctg
caggttgccagccgtgaattaaacatacccatgtcttctctgcacatctgtgaaacaagt
acggccacagtgcctaatacaattgccacggcagcttccattggttcggatgtcaacggc
agagccgttcagaatgcttgtcagatccttctgaaacgcctcgagcccatcattaagaaa
aatccagaaggtacatgggaagactggatagaatctgctttcgaacaaagaatcagtctt
tcagccactggatacttcaggggctacaaggccttcatggactgggagaagggagaagga
gacccttttccatactatgtctatggagcagcctgttcagaggttgaaattgactgcctg
acgggagctcacaagaaaatcagaacagacattgtcatggatgcatgttgcagcctaaat
cccgctattgatattgggcaggttgaaggttcctttattcagggaatgggcctttatacc
actgaagagctgaaatattccccagaaggtgttctgtactctcgaggcccagacgagtac
aaaattccaaccatcactgacgtcccagaggagttcaatgtctccctgttgccatcctca
caaaccccaccaaccatctattcatccaagggcctgggagagtctgggatgttcttgggc
tcgtctgtgttctttgccatcactgatgctgtggccacagcacgcagggaaagagacaca
gtggaggacttcacagtgaggagcccagcaacgccagaacgggttcgaatggcctgtgca
gatcgtttcacagagatgatcccaagagatgacccgaagacatttagaccttggtctatc
cctatagcataa

DBGET integrated database retrieval system