KEGG   Ailuropoda melanoleuca (giant panda): 100471100Help
Entry
100471100         CDS       T01329                                 

Gene name
ARHGAP5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:aml00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100471100 (ARHGAP5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    100471100 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1503 aa AA seqDB search
MMAKNKEPRPPSYTISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLGTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASRLLQLDHGRLRLYHDSTSIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLNFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSMSKNLPILRHQGQQ
LANKLQCPFVDVPPGTYPRKFNETQIKQALRGVLESVKHNLDVVSPVPTSKDVSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
IHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLVKTIEAGIGKNPRKQTSRVPLA
HPEDMDPSDNYAEPIDTIFKQKGYSDETYVVPDDSQTRIIKIRNSFVNNTQGDEENGFSD
RTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDP
LLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNY
FGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNIS
LVSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVRKFHP
VNYDVFRYVITHLNRVSQQNKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVE
TFIQQCQFFFYNGEIVETVNTVTPPPPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPL
GII
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgccccccatcctatactatcagtgtagttggactc
tctgggactgaaaaagacaaaggtaactgtggagttggaaagtcttgtttgtgcaataga
tttgtacgctcaaaagcagatgaatattacccagagcatacttctgtgcttagcaccatt
gactttggaggacgagtagtaaacaatgatcactttttgtactggggtgacataacacaa
aatggtgaagatggagtagaatgcaaaattcatgtcattgaacaaacagagttcattgat
gaccagactttcttgcctcatcggagtacgaatttgcaaccatatataaaacgtgcagct
gcctctaaattgcagtcagcagaaaaactaatgtacatttgcactgatcaactgggcttg
gagcaagactttgaacagaagcaaatgcctgaagggaagctcaatgtagatggattttta
ctgtgcattgatgtgagtcagggatgcaataggaagtttgatgatcaacttaaatttgtg
aataatctttttgtccaactatcaaaatcaaaaaaacctgtaataatagcagcaactaaa
tgtgatgaatgcgtggatcactatcttagagaagttcaggcatttgcttcaaacaaaaag
aaccttcttgtagtggaaacatcagcacgatttaatgtcaacattgagacatgtttcact
gcactggtacaaatgttggataaaactcgtggcaagcctaaaattattccctatctggat
gcttataaaacacagcgacaacttgttgtcacagcaacagataagtttgaaaaacttgtg
cagactgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaatcat
cctgattatgaagaatacatcaacttagagggaacaagaaaggccagaaatacattttca
aaacatatagaacaacttaaacaagaacatataagaaaaaggagagaagaatatataaat
actttaccaagagcttttaacactcttttgccaaacctagaagagattgaacatttgaat
tggtcagaagctttgaagttaatggagaaaagagcagattttcaattatgttttgtggtg
ctagaaaaaacaccttgggatgaaactgaccatatagataaaattaatgatagacgaatc
ccatttgacctcctgggcactttagaagccgaaaaggtttatcagaaccacgtacaacat
ctaatatcagagaagagaagggtagaaatgaaggaaaaattcaaaaagactttggaaaaa
attcaattcatttcacctgggcagccatgggaagaagttatgtgctttgttatggaggat
gaagccttcaaatatatcactgaggctgatagcaaagaggtgtatggtaggcatcagcga
gaaatagttgaaaaagccaaagaagagtttcaggaaatgctttttgagcactctgaactt
ttttatgatttagatcttaatgcaacacctagttcagataaaatgagtgaaattcataca
gttttgagtgaagaacctagatataaagctttacagaaacttgcacctgatagggaatct
cttctacttaagcacatagggtttgtttatcatcccactaaagaaacctgtcttagtggc
caaaattgtacagacatcaaagtggagcaattacttgctagtagacttttacagttggat
catggccgcttacggttatatcatgatagcaccagtatagataaagttaaccttttcatt
ttagggaaggatggccttgctcaagaactagcaaatgagataagaacacaatccactgat
gatgagtatgccttagatggaaaaatttacgaacttgatcttcggccagttgatgccaag
tcgccttacttcttaagtcaattgtggactgccgcctttaaaccacatgggtgcttctgt
gtatttaattccattgagtcactgaattttattggggaatttattggaaaaataagaact
gaagcttctcagatcagaaaagataagtacatggctaatcttccatttactttaattctg
gctaatcagagagattctatgagtaagaatctaccaattctcaggcaccaagggcagcag
ttggcaaacaagttacaatgcccttttgtagatgtacctcctggtacatatcctcgtaaa
tttaatgaaacccaaataaagcaagctctcagaggagtattagaatcagttaagcataat
ttagatgtggtgagcccagttcccaccagtaaggatgtatcagaagctgacctgagaatt
gtcatgtgtgccatgtgtggtgatccctttagtgtggatcttattctttcacccttcctt
gattctcattcttgtagtgctgctcaagctggacaaaataattccctaatgcttgataaa
ataattggtgaaaaaaggaggcgaatacagattacaattttatcataccattcttcaatt
ggagtaaggaaagatgaactggttcatgggtatatattagtttattctgccaaacggaaa
gcatcaatgggaatgcttcgagcatttctgtcagaagttcaggacaccattcctgtacag
ctggtggcagttaccgacagccaagcagatttttttgaaaatgaggccatcaaggaatta
atgactgaaggagaacacattgcaactgagatcactgctaaatttacagcactgtattct
ttatctcagtatcatcggcaaactgaggtctttacactgtttttcagtgatgttctagag
aaaaaaaatatgatagaaaattcctatttatctgataatacaagggaatcaactcatcaa
agtgaggatgtttttctaccatctcccagagactgttttccatacaacaactaccctgat
tcggatgatgatacagaagcaccccctccttatagcccgattggagatgatgtacagttg
cttccaacacctagtgaccgttctagatatagattagatttagaaggaaatgaatatcct
attcatagcaccccaaactgtcatgaccatgaacgcaaccataaagtgcctccacctatt
aaacctaaaccagttgtacctaagacaaatgtgaaaaaactggatccaaatcttgtaaaa
acaattgaagctggtattggtaaaaatccaagaaaacagacttcccgggtgcctttggca
catcctgaagatatggatccttcagataactatgcggaacccattgacacaattttcaaa
cagaagggctattctgatgagacatatgttgtcccggatgatagtcagactcgcattatt
aaaattcgaaactcatttgtaaataacacccaaggagatgaagaaaatggattttctgat
agaacgtcaaaaagtcatggggaaaggaggccttcaaaatacaaatacaaatctaaaacc
ctgtttagtaaagccaagtcatactatagaagaacacattcagatgcaagtgatgatgag
gcttttaccacttctaaaacaaaaagaaaaggaaggcatcgtggaagtgaagaagatcca
cttctttctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacttcagac
caggagttagatgataagaaaatgaagaagaaaacccacaaagtaaaagaagataaaaag
cagaaaaagaaaacaaagaacttcaatccaccaacacgtagaaattgggaaagtaattac
tttgggatgcccctccaggatctggttacagctgagaagcccataccactatttgttgaa
aaatgtgtggaatttattgaagatacaggattatgtactgaaggactctaccgtgttagt
gggaacaaaactgatcaagacaatattcaaaagcagtttgatcaggatcataatatcagt
ctagtatcaatggaagtaacagtaaatgctgtggctggagctcttaaagctttctttgca
gatctgcctgaccctttaattccatattctcttcatccagagttactggaagcagcaaaa
atcccagataaaacagaacgtcttcatgcattgaaagaaattgttaggaaatttcatcct
gtaaactatgatgtattcagatatgtaataacacatctaaacagggttagtcagcaaaat
aaaatcaacctaatgacagcagacaacttatccatctgtttttggccaaccttgatgaga
cccgattttgaaaatcgagagtttctgtctaccactaagatccatcaatctgttgttgaa
acattcattcagcagtgtcagtttttcttttataatggagaaattgtagaaactgtgaac
accgtcactcctccaccaccttcaaacccaggacagttggtggaaccaatggtaccgctt
cagttgccaccacccttgcaacctcagctgattcaaccacagttacagacagatcctctt
ggtattatataa

DBGET integrated database retrieval system