KEGG   Ailuropoda melanoleuca (giant panda): 100471118Help
Entry
100471118         CDS       T01329                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1-like
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:aml00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:aml04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:aml04070]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:aml04114]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:aml04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 663 aa AA seqDB search
MNIEKFLYYKRAELTLFGTCDNTISLTSIFVLHTWFLSMIRDEFRGGKINVEKTYRLLEK
LDIPCNYIHVKSIFKDNDRLKQGRITIEEFRSIYRIIAHREEIIEIFNTYSGNQKFLFEK
NLLQFLIQEQYALDMTTNIAFEIIQKYEPIEEVKRAHQMSFEGFTRYMGSPECLVFKTDC
GKVYQDMTQPLNDYFISSSHNTYLVSDQLLGPSDLWGYVSALVKGCRCLEIDCWDGSRNE
PVVYHGYTLTSKLLFKTVIQAIQKYAFITSDYPVVLSLENHCSPSQQEVMADILQSVFGD
ALLSDMLDDFPDKLPSPQALKFKILVRNKKIGSLRETRERKGSDKHGQVEEYEEIDEDVE
DEVKGSQALAVLENDSEKEPRTTPVTGLPLFRRRRVKVSMALSDLVIYTKAEKFRSFRHS
RLYQQFNESNSIGESEARKLSKLKAQEFILHTRKFITRIYPKATRANSSNFNPQEFWNIG
CQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPQFLRDIETQFNPNETPKDIDPVTLTI
RLISGIQLPPSYHSSSNKADTLVVLEIFGVPNDHVKQQTRVIKRNAFCPRWNETFTFIIQ
VPELALMRFVVENQGLITGNEFLGQYTLPVLCMNRGYRRVPLFSKLGESLEPAALFIYVW
YIR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgagaaattcctttactacaaaagggcagagttaactctatttggaacctgt
gacaacacaatttccttaacttctatttttgtgcttcatacatggtttttgtcgatgatt
cgagatgaatttagaggtggaaaaattaacgtagaaaaaacttacagattacttgaaaaa
ttagatattccgtgcaattatattcatgtgaaatctattttcaaggataatgacaggctg
aaacaaggaagaatcaccatagaagaatttagatcaatttatcgaattatcgcgcacaga
gaagaaattattgagattttcaacacgtattctggaaaccagaaatttctttttgaaaaa
aatctgcttcaatttttgatacaagaacagtatgcacttgacatgaccacaaatattgct
tttgagatcattcaaaaatatgagcctattgaagaagttaagagagcacatcagatgtcg
tttgaaggttttacaagatacatgggttcacctgaatgtctagtatttaaaactgattgt
ggaaaagtttatcaagatatgactcaaccattaaatgattattttatttcaagttcacat
aatacatacttggtatctgaccagttactgggaccaagtgacctttggggatatgtaagt
gcccttgtgaaaggatgccgttgcctggaaattgactgctgggatggatcacgaaatgaa
cctgttgtataccatggttatacactcaccagcaagcttctgtttaaaactgttatccaa
gcaatacagaaatatgcattcataacatctgactacccagtggtgctctctttagaaaat
cactgctccccttcccaacaagaagtgatggcagacattttgcagtctgtttttggagat
gccttgctttctgatatgcttgatgattttccagacaaactaccttcaccacaggcatta
aaattcaaaatattagttagaaacaagaaaataggatccttaagggaaacccgtgaaaga
aaaggctctgataagcacggtcaggtagaggaatatgaagagatagatgaagatgtggag
gatgaagtcaaaggatcacaagctttggctgttttagaaaacgattcagaaaaggaacca
aggacaacacctgtaactggattaccacttttcaggagaaggagggtaaaagtgtctatg
gccctatctgatcttgtcatttataccaaagctgagaagttcagaagctttcggcattca
agattgtatcagcagtttaatgaaagtaattctattggggagtcagaagcccgaaaactt
tcaaagttgaaagctcaggagtttattcttcacaccaggaagttcattaccagaatttat
cccaaagcaacaagagcaaactcctctaattttaatcctcaagaattttggaatataggt
tgccaaatggtggccttaaatttccagacccctggtttgcctatggatcttcaaaatggg
aaattcttggataatggtggttctggatatattttgaaaccacaattcctaagagatatt
gaaacacagtttaatccaaatgaaacaccaaaagacattgatccagttacactcacgata
aggctcatcagtggtatccagttacctcccagttaccattcatcatctaacaaagcagac
acactagtggttctagaaatttttggtgttccaaatgatcatgtgaaacagcagactcgt
gtaattaaaagaaatgctttttgtccaagatggaatgaaacattcacattcattattcag
gtgccagaattggctctgatgcgttttgttgttgaaaatcaaggtttaataaccggaaat
gaatttcttggccaatatactttaccagttctatgcatgaacagaggttaccgtcgtgtt
cctctgttttccaaactgggcgagagtctggagcctgctgccctctttatttacgtgtgg
tacatcagatag

DBGET integrated database retrieval system