KEGG   Ailuropoda melanoleuca (giant panda): 100471118Help
Entry
100471118         CDS       T01329                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1-like
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100471118
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100471118
   04070 Phosphatidylinositol signaling system
    100471118
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100471118
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100471118
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100471118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 663 aa AA seqDB search
MNIEKFLYYKRAELTLFGTCDNTISLTSIFVLHTWFLSMIRDEFRGGKINVEKTYRLLEK
LDIPCNYIHVKSIFKDNDRLKQGRITIEEFRSIYRIIAHREEIIEIFNTYSGNQKFLFEK
NLLQFLIQEQYALDMTTNIAFEIIQKYEPIEEVKRAHQMSFEGFTRYMGSPECLVFKTDC
GKVYQDMTQPLNDYFISSSHNTYLVSDQLLGPSDLWGYVSALVKGCRCLEIDCWDGSRNE
PVVYHGYTLTSKLLFKTVIQAIQKYAFITSDYPVVLSLENHCSPSQQEVMADILQSVFGD
ALLSDMLDDFPDKLPSPQALKFKILVRNKKIGSLRETRERKGSDKHGQVEEYEEIDEDVE
DEVKGSQALAVLENDSEKEPRTTPVTGLPLFRRRRVKVSMALSDLVIYTKAEKFRSFRHS
RLYQQFNESNSIGESEARKLSKLKAQEFILHTRKFITRIYPKATRANSSNFNPQEFWNIG
CQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPQFLRDIETQFNPNETPKDIDPVTLTI
RLISGIQLPPSYHSSSNKADTLVVLEIFGVPNDHVKQQTRVIKRNAFCPRWNETFTFIIQ
VPELALMRFVVENQGLITGNEFLGQYTLPVLCMNRGYRRVPLFSKLGESLEPAALFIYVW
YIR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgagaaattcctttactacaaaagggcagagttaactctatttggaacctgt
gacaacacaatttccttaacttctatttttgtgcttcatacatggtttttgtcgatgatt
cgagatgaatttagaggtggaaaaattaacgtagaaaaaacttacagattacttgaaaaa
ttagatattccgtgcaattatattcatgtgaaatctattttcaaggataatgacaggctg
aaacaaggaagaatcaccatagaagaatttagatcaatttatcgaattatcgcgcacaga
gaagaaattattgagattttcaacacgtattctggaaaccagaaatttctttttgaaaaa
aatctgcttcaatttttgatacaagaacagtatgcacttgacatgaccacaaatattgct
tttgagatcattcaaaaatatgagcctattgaagaagttaagagagcacatcagatgtcg
tttgaaggttttacaagatacatgggttcacctgaatgtctagtatttaaaactgattgt
ggaaaagtttatcaagatatgactcaaccattaaatgattattttatttcaagttcacat
aatacatacttggtatctgaccagttactgggaccaagtgacctttggggatatgtaagt
gcccttgtgaaaggatgccgttgcctggaaattgactgctgggatggatcacgaaatgaa
cctgttgtataccatggttatacactcaccagcaagcttctgtttaaaactgttatccaa
gcaatacagaaatatgcattcataacatctgactacccagtggtgctctctttagaaaat
cactgctccccttcccaacaagaagtgatggcagacattttgcagtctgtttttggagat
gccttgctttctgatatgcttgatgattttccagacaaactaccttcaccacaggcatta
aaattcaaaatattagttagaaacaagaaaataggatccttaagggaaacccgtgaaaga
aaaggctctgataagcacggtcaggtagaggaatatgaagagatagatgaagatgtggag
gatgaagtcaaaggatcacaagctttggctgttttagaaaacgattcagaaaaggaacca
aggacaacacctgtaactggattaccacttttcaggagaaggagggtaaaagtgtctatg
gccctatctgatcttgtcatttataccaaagctgagaagttcagaagctttcggcattca
agattgtatcagcagtttaatgaaagtaattctattggggagtcagaagcccgaaaactt
tcaaagttgaaagctcaggagtttattcttcacaccaggaagttcattaccagaatttat
cccaaagcaacaagagcaaactcctctaattttaatcctcaagaattttggaatataggt
tgccaaatggtggccttaaatttccagacccctggtttgcctatggatcttcaaaatggg
aaattcttggataatggtggttctggatatattttgaaaccacaattcctaagagatatt
gaaacacagtttaatccaaatgaaacaccaaaagacattgatccagttacactcacgata
aggctcatcagtggtatccagttacctcccagttaccattcatcatctaacaaagcagac
acactagtggttctagaaatttttggtgttccaaatgatcatgtgaaacagcagactcgt
gtaattaaaagaaatgctttttgtccaagatggaatgaaacattcacattcattattcag
gtgccagaattggctctgatgcgttttgttgttgaaaatcaaggtttaataaccggaaat
gaatttcttggccaatatactttaccagttctatgcatgaacagaggttaccgtcgtgtt
cctctgttttccaaactgggcgagagtctggagcctgctgccctctttatttacgtgtgg
tacatcagatag

DBGET integrated database retrieval system