KEGG   Ailuropoda melanoleuca (giant panda): 100471118Help
Entry
100471118         CDS       T01329                                 

Gene name
PLCZ1
Definition
(RefSeq) phospholipase C, zeta 1
  KO
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100471118 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100471118 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    100471118 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100471118 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100471118 (PLCZ1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100471118 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 625 aa AA seqDB search
MIRDEFRGGKINVEKTYRLLEKLDIPCNYIHVKSIFKDNDRLKQGRITIEEFRSIYRIIA
HREEIIEIFNTYSGNQKFLFEKNLLQFLIQEQYALDMTTNIAFEIIQKYEPIEEVKRAHQ
MSFEGFTRYMGSPECLVFKTDCGKVYQDMTQPLNDYFISSSHNTYLVSDQLLGPSDLWGY
VSALVKGCRCLEIDCWDGSRNEPVVYHGYTLTSKLLFKTVIQAIQKYAFITSDYPVVLSL
ENHCSPSQQEVMADILQSVFGDALLSDMLDDFPDKLPSPQALKFKILVRNKKIGSLRETR
ERKGSDKHGQVEEYEEIDEDVEDEVKGSQALAVLENDSEKEPRTTPVTGLPLFRRRRVKV
SMALSDLVIYTKAEKFRSFRHSRLYQQFNESNSIGESEARKLSKLKAQEFILHTRKFITR
IYPKATRANSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPQFLR
DIETQFNPNETPKDIDPVTLTIRLISGIQLPPSYHSSSNKADTLVVLEIFGVPNDHVKQQ
TRVIKRNAFCPRWNETFTFIIQVPELALMRFVVENQGLITGNEFLGQYTLPVLCMNRGYR
RVPLFSKLGESLEPAALFIYVWYIR
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagatgaatttagaggtggaaaaattaacgtagaaaaaacttacagattactt
gaaaaattagatattccgtgcaattatattcatgtgaaatctattttcaaggataatgac
aggctgaaacaaggaagaatcaccatagaagaatttagatcaatttatcgaattatcgcg
cacagagaagaaattattgagattttcaacacgtattctggaaaccagaaatttcttttt
gaaaaaaatctgcttcaatttttgatacaagaacagtatgcacttgacatgaccacaaat
attgcttttgagatcattcaaaaatatgagcctattgaagaagttaagagagcacatcag
atgtcgtttgaaggttttacaagatacatgggttcacctgaatgtctagtatttaaaact
gattgtggaaaagtttatcaagatatgactcaaccattaaatgattattttatttcaagt
tcacataatacatacttggtatctgaccagttactgggaccaagtgacctttggggatat
gtaagtgcccttgtgaaaggatgccgttgcctggaaattgactgctgggatggatcacga
aatgaacctgttgtataccatggttatacactcaccagcaagcttctgtttaaaactgtt
atccaagcaatacagaaatatgcattcataacatctgactacccagtggtgctctcttta
gaaaatcactgctccccttcccaacaagaagtgatggcagacattttgcagtctgttttt
ggagatgccttgctttctgatatgcttgatgattttccagacaaactaccttcaccacag
gcattaaaattcaaaatattagttagaaacaagaaaataggatccttaagggaaacccgt
gaaagaaaaggctctgataagcacggtcaggtagaggaatatgaagagatagatgaagat
gtggaggatgaagtcaaaggatcacaagctttggctgttttagaaaacgattcagaaaag
gaaccaaggacaacacctgtaactggattaccacttttcaggagaaggagggtaaaagtg
tctatggccctatctgatcttgtcatttataccaaagctgagaagttcagaagctttcgg
cattcaagattgtatcagcagtttaatgaaagtaattctattggggagtcagaagcccga
aaactttcaaagttgaaagctcaggagtttattcttcacaccaggaagttcattaccaga
atttatcccaaagcaacaagagcaaactcctctaattttaatcctcaagaattttggaat
ataggttgccaaatggtggccttaaatttccagacccctggtttgcctatggatcttcaa
aatgggaaattcttggataatggtggttctggatatattttgaaaccacaattcctaaga
gatattgaaacacagtttaatccaaatgaaacaccaaaagacattgatccagttacactc
acgataaggctcatcagtggtatccagttacctcccagttaccattcatcatctaacaaa
gcagacacactagtggttctagaaatttttggtgttccaaatgatcatgtgaaacagcag
actcgtgtaattaaaagaaatgctttttgtccaagatggaatgaaacattcacattcatt
attcaggtgccagaattggctctgatgcgttttgttgttgaaaatcaaggtttaataacc
ggaaatgaatttcttggccaatatactttaccagttctatgcatgaacagaggttaccgt
cgtgttcctctgttttccaaactgggcgagagtctggagcctgctgccctctttatttac
gtgtggtacatcagatag

DBGET integrated database retrieval system