KEGG   Ailuropoda melanoleuca (giant panda): 100471129Help
Entry
100471129         CDS       T01329                                 

Gene name
PADI4
Definition
(RefSeq) peptidyl arginine deiminase, type IV
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     100471129 (PADI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 702 aa AA seqDB search
MLKLGRGRLCFQAHPRCCWQLTPSSSAPAGYTSFSINASPGVVVDVAHSPPAKKNSTGSS
KWSLDPSLEVSLRMKAASSSTGDQKVQISYYGPKTNPVQALLYVTGVEISLSADITRTGK
VNPAGAKKGQKTWTWGPRGQGAILLVNCDKDNPKSSTIDCRDDEVLDSKDLQDMSPVTLT
TNTPRDFFTKHQLLLHVAKSEMDKVRVFQASRGKQISSYRAVLGPQQPSHRLDLPGGQHS
VDFYVEGLAFPDVNFPGLISLTVSLLDTSNPDLPAALLFQDSVVFRVAPWIMTPNTQPPE
EVYVCRVLENADFLKSVIALAKEAKCKLTIPSQKQSKDDRWMQDEIEIGYIQAPHKTLPV
VFDSPRNRGLKEFPIKCMLGPDFGYVTRGPETGEVTTFDSFGNLEVSPPVTVGKKKYPLG
RILIGSSSYPSAESQEMHQAVQDFLSAQQVQAPVRLYSDWLFVGHVDEFLSFVPAHKKGF
RLLLASPRSCYRLFEEQLKEGHGEAVLFEGIKKKNRKIKDILSDKNLREHNSYVEVLAWV
PGRHHSPGRLNHPPHRRPFRCGLHPLLVAGLLCPVIPTPALHPLINPPRRELGLTERDII
DIPQLFKLQEEVSGILKAEAYFPNMVNMLVLGKHLGIPKPFGPVINGQCCLEEKVRSLLE
PLGLHCTFIDDFYAYHVRHGEVHCGTNVRRQPFSFKWWHMVP
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcttggccgaggcaggctttgcttccaagctcacccacgttgttgttggcag
cttactccatcaagctctgcccccgcgggctacacgtccttcagcatcaatgcctcccca
ggagtggtcgtggatgttgcccacagccctccagccaagaagaattccacaggttcctcc
aagtggtccctggaccctagcctggaggtgagcctgaggatgaaagctgctagcagtagc
acaggtgaccaaaaggttcagatttcatattatggacccaagaccaacccagtccaagcc
ctgctctatgtcaccggtgtcgaaatttccttgagcgcggacatcacccgcactggcaaa
gtgaatcccgctggagccaagaagggccagaagacctggacctggggcccccgcgggcaa
ggcgccatcctgctggtgaactgtgacaaggacaatcccaaatcttccaccatagactgc
agggatgatgaggtgcttgacagcaaagacctgcaggacatgtccccggtgaccctgacc
accaacacccccagggacttcttcaccaaacaccaactgcttctccacgtggccaaatcg
gagatggacaaagtccgggtgttccaagccagccggggcaaacagatctccagttacagg
gcagtcctggggccacagcagcccagtcatcgcctggatctcccaggtggccagcacagt
gtggacttctacgtggagggcctggctttcccagacgtcaacttcccggggctcatttcc
ctcaccgtctccctgctggacacgtccaacccggacctccctgccgctctccttttccaa
gacagtgtggtcttccgtgtggccccctggatcatgacccccaacacccagcccccagag
gaggtatacgtgtgcagggtacttgaaaatgcggacttcctcaagtcagtgatcgctctg
gccaaggaagccaagtgcaagttgaccatcccctcccagaagcagagcaaggatgaccgg
tggatgcaggacgagatagagatcggctacatccaagcgccgcacaagaccttgcctgtg
gtctttgactctccgaggaacaggggcctgaaggagttccccatcaaatgcatgctgggt
ccagattttggctacgtgactcgaggacccgaaacaggagaggtgactaccttcgactcc
tttggaaacctggaagtgagccccccggtcacggtggggaagaagaaataccccctgggc
agaatccttattgggagcagcagctaccccagcgctgagagccaggagatgcaccaggcc
gtgcaggacttcctcagtgcccagcaggtgcaggccccggtgaggctctactccgactgg
ctgttcgtgggccacgtggacgagttcctgagcttcgtccctgcacacaagaagggcttc
aggctgctgctggccagccccaggtcctgctacagattgtttgaggagcaactaaaggag
ggccacggcgaggctgtgctatttgaaggcatcaagaaaaaaaaccggaaaataaaggac
attctgtcagacaagaacctgagagaacataattcttatgtggaggtactagcctgggtg
cccggcagacaccacagcccgggcagactgaaccacccaccccaccgccgtcccttccgt
tgtggtctgcaccccctcctcgtggcaggcctgctgtgccccgtcatccccactcccgcc
ctccaccccctcatcaacccccccagacgggagctgggcctgactgagcgggacatcatc
gacatcccccagctcttcaagctccaggaggaggtcagcgggatcctcaaggctgaagcc
tattttccaaacatggtgaacatgctggtgctgggcaaacacctgggcatccccaagccc
ttcgggcccgtcatcaacggccagtgctgcctggaggagaaggtgcggtccctgctcgag
ccgctgggcctccactgcaccttcatcgacgacttctatgcctaccacgtgcggcacggg
gaggtgcactgcggcaccaatgtgcgccggcagcccttctccttcaagtggtggcacatg
gtgccctga

DBGET integrated database retrieval system