KEGG   Ailuropoda melanoleuca (giant panda): 100471183Help
Entry
100471183         CDS       T01329                                 

Definition
OTU domain-containing protein 5-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100471183
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100471183
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100471183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 510 aa AA seqDB search
MGARSRASPPPQGPLPGPPGALHRWALAVPPGAXXGPRPQQASPPPCGGPVGPGGGPGDA
LGAAAAGVGAAGVVVGVGGAVGVGSCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAGYN
SEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGD
QDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPV
EVYQYSTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGFAE
QSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQV
RGPSQPRKASATCSSATAAASSALEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTV
LALAKPPSPCAPGTSSQFSAGADRATPPLVSLYPALECRALIQQMSPSAFGLNDWDDDEI
LASVLAVSQQEYLDSMKKNKVHRDPPPDKS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccgttcccgggcctcgccaccgcctcagggcccgctaccgggaccaccagga
gcgcttcaccgctgggcgctggccgtgccgcctggcgctgnnncgggtccgcggccacag
caggcctctcctcctccttgcgggggccccgttggtcccggcggcggtcccggcgacgcg
ctgggtgcagcggcggcgggtgtgggtgcagcgggcgtggtggtgggcgtgggcggagcc
gtaggcgttggcagttgctgctcggggccgggccacagcaagcggcggcgtcaagccccc
ggggtcggagcggttggagggggcagtccagagcgtgaggaggtcggcgcgggttataac
agtgaagacgagtatgaagcagctgcagctcgcatcgaggctatggacccagcaaccgtt
gagcagcaggagcactggtttgaaaaggccctgagagacaagaagggcttcatcatcaag
cagatgaaggaggacggcgcctgtctcttccgggctgtagctgaccaggtgtatggagac
caggacatgcatgaggttgtgcggaagcattgcatggactatctgatgaagaatgctgac
tacttctccaactatgtcacagaggacttcaccacctacatcaacaggaagcggaaaaac
aactgccatggcaaccacattgagatgcaggccatggctgagatgtacaaccggcccgtg
gaggtgtaccagtatagcacagaaccaatcaacacattccatgggatccatcagaacgag
gatgaacccatccgcgtcagctaccatcggaatatccactacaattcagtggtgaatccc
aacaaggccaccattggtgtggggctaggcctgccatcattcaaacccgggtttgcagaa
cagtccctgatgaagaatgccataaaaacatcagaggagtcatggattgaacagcaaatg
ctggaagacaagaagcgggccacagactgggaagccacaaatgaggccattgaggagcag
gtggctcgagaatcctacctgcagtggctgagggatcaggagaaacaggcccgccaagtc
cgcggccctagccagccccggaaagccagcgccacatgcagttctgccacagcagcagcc
tccagtgccctggaggagtggaccagccgctccccgcggcagcggagttcagcctcttca
cccgagcaccctgagctgcacgccgagctgggcatcaagcccccttccccaggcactgtc
ttagctcttgccaaacctccttcgccctgtgcaccaggtacaagcagccagttctctgca
ggggccgaccgggctactccccccctcgtgtccctctaccctgctctggagtgccgggcc
ctcattcagcagatgtccccctctgcctttggtctgaacgactgggatgatgatgagatc
ctagcatcggtgctggcagtgtcgcaacaggaatacctagacagtatgaagaaaaacaaa
gtgcacagagatccacccccagacaagagttga

DBGET integrated database retrieval system