KEGG   Ailuropoda melanoleuca (giant panda): 100471203Help
Entry
100471203         CDS       T01329                                 

Gene name
XIAP
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Platinum drug resistance
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Apoptosis - multiple species
Necroptosis
Focal adhesion
NOD-like receptor signaling pathway
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100471203 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100471203 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100471203 (XIAP)
   04215 Apoptosis - multiple species
    100471203 (XIAP)
   04217 Necroptosis
    100471203 (XIAP)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100471203 (XIAP)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100471203 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100471203 (XIAP)
   05222 Small cell lung cancer
    100471203 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    100471203 (XIAP)
   05145 Toxoplasmosis
    100471203 (XIAP)
  Drug resistance
   01524 Platinum drug resistance
    100471203 (XIAP)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100471203 (XIAP)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100471203 (XIAP)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100471203 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 497 aa AA seqDB search
MTFNSFEGSKTCVPADIDKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAIDRWQYGDSAVGRHRKVSPNCRFINGFYFENAAAQPTNPGIQNGQYKTESY
LGNRNHFVLDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNIRSE
SDVVSSDRNFPNSTNVPRNPAMADYEARIITFGTWIYSVNKEQLARAGFYALGDGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQEYVSNIHLTHSFEDSMVRSAEKTP
SLTKRIDDAILQNPMLQEAIRMGFNFKDVKKIMEEKIQTSGSNYKSLEILVSDLVSAQKD
NTQDESSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacccgcagacatcgataaggat
gaagaatttgtagaagagtttaatagattaaaaacttttgctaatttcccaagtagtagt
cctgtttccgcatcaacgctagcacgagctggttttctatatactggtgaaggagacacc
gtgcgttgctttagttgtcatgcagcaatagatagatggcaatatggagactcggcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaat
gctgctgcacaacctacaaatccgggtatccaaaatggtcagtataaaacggaaagctac
ctgggaaacagaaatcattttgttttagacaggccatccgagactcatgcagactatctt
ttgagaactggacaggtcgtagatatatccgacaccatatacccaaggaaccctgccatg
tatagtgaagaagctagattgaagtcatttcagaactggccagactatgcccacttgacc
ccaagagagttagctagtgctggactctactacacaggtattgatgatcaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgcgatcgtgcatggtcagaacac
aggcgacactttcctaactgcttctttgttctgggccggaatgttaacattcgaagtgaa
tctgatgtggtgagttctgataggaatttcccaaattcaacaaatgttccaagaaatcca
gccatggcagattatgaagcacggatcattacttttgggacgtggatatactcagttaac
aaggagcagcttgcgagagctggattttatgctttaggggatggtgataaagtaaaatgc
tttcattgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacat
gctaagtggtatccagggtgtaaatatctgttagaagagaagggacaagaatatgtaagc
aatattcatttaacccattcatttgaggactctatggtaagatctgctgaaaaaacacca
tcattaactaaaagaattgatgatgccatcttacaaaatcctatgttacaagaagctata
cgaatgggattcaatttcaaggacgttaagaaaataatggaggaaaaaattcagacatct
gggagcaactataaatcacttgagattctggtttcagatctagtgagtgctcagaaagac
aatacacaagatgaatcaagccagacttcattgcaaaaagagattagtgctgaagagcag
ctaaggctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgcggtg
gttttcattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaa
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system