KEGG   Ailuropoda melanoleuca (giant panda): 100471203Help
Entry
100471203         CDS       T01329                                 

Gene name
XIAP
Definition
(RefSeq) X-linked inhibitor of apoptosis, E3 ubiquitin protein ligase
  KO
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100471203 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    100471203 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100471203 (XIAP)
  Cellular commiunity
   04510 Focal adhesion
    100471203 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100471203 (XIAP)
   05222 Small cell lung cancer
    100471203 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    100471203 (XIAP)
   05145 Toxoplasmosis
    100471203 (XIAP)
Mitochondrial biogenesis [BR:aml03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100471203 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 599 aa AA seqDB search
MSQVFLILEKKNNEIIARPALHLQDALAARVMLSAGLPLWNARRACGHTQLQPRKPRLTK
CTCRGGLDLRAQPHGAPQASQGSKEWSGNAAEKVDKSYFQEKMTFNSFEGSKTCVPADID
KDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDTVRCFSCHAAIDRWQYGDS
AVGRHRKVSPNCRFINGFYFENAAAQPTNPGIQNGQYKTESYLGNRNHFVLDRPSETHAD
YLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIDDQV
QCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNIRSESDVVSSDRNFPNSTNVPR
NPAMADYEARIITFGTWIYSVNKEQLARAGFYALGDGDKVKCFHCGGGLTDWKPSEDPWE
QHAKWYPGCKYLLEEKGQEYVSNIHLTHSFEDSMVRSAEKTPSLTKRIDDAILQNPMLQE
AIRMGFNFKDVKKIMEEKIQTSGSNYKSLEILVSDLVSAQKDNTQDESSQTSLQKEISAE
EQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaagtttttctcattctagaaaaaaaaaacaatgaaatcattgccagacctgct
cttcacctccaggatgcccttgcagccagagtcatgctgagtgccgggctgcctctctgg
aatgccaggcgggcgtgtgggcacactcagctgcagcccaggaagccacggctcaccaaa
tgcacctgtagaggtggcttggatctccgtgctcaacctcacggagctccacaggcttca
cagggcagcaaggagtggtctggcaatgcagcagaaaaggtggacaagtcctattttcaa
gagaagatgacttttaacagttttgaaggatctaaaacttgtgtacccgcagacatcgat
aaggatgaagaatttgtagaagagtttaatagattaaaaacttttgctaatttcccaagt
agtagtcctgtttccgcatcaacgctagcacgagctggttttctatatactggtgaagga
gacaccgtgcgttgctttagttgtcatgcagcaatagatagatggcaatatggagactcg
gcagttggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttatttt
gaaaatgctgctgcacaacctacaaatccgggtatccaaaatggtcagtataaaacggaa
agctacctgggaaacagaaatcattttgttttagacaggccatccgagactcatgcagac
tatcttttgagaactggacaggtcgtagatatatccgacaccatatacccaaggaaccct
gccatgtatagtgaagaagctagattgaagtcatttcagaactggccagactatgcccac
ttgaccccaagagagttagctagtgctggactctactacacaggtattgatgatcaagtg
cagtgcttttgttgtggtggaaaactgaaaaattgggaaccttgcgatcgtgcatggtca
gaacacaggcgacactttcctaactgcttctttgttctgggccggaatgttaacattcga
agtgaatctgatgtggtgagttctgataggaatttcccaaattcaacaaatgttccaaga
aatccagccatggcagattatgaagcacggatcattacttttgggacgtggatatactca
gttaacaaggagcagcttgcgagagctggattttatgctttaggggatggtgataaagta
aaatgctttcattgtggaggagggctaactgattggaagcccagtgaagacccttgggaa
caacatgctaagtggtatccagggtgtaaatatctgttagaagagaagggacaagaatat
gtaagcaatattcatttaacccattcatttgaggactctatggtaagatctgctgaaaaa
acaccatcattaactaaaagaattgatgatgccatcttacaaaatcctatgttacaagaa
gctatacgaatgggattcaatttcaaggacgttaagaaaataatggaggaaaaaattcag
acatctgggagcaactataaatcacttgagattctggtttcagatctagtgagtgctcag
aaagacaatacacaagatgaatcaagccagacttcattgcaaaaagagattagtgctgaa
gagcagctaaggctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatatt
gcggtggttttcattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagtt
gacaaatgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system