KEGG   Ailuropoda melanoleuca (giant panda): 100471203Help
Entry
100471203         CDS       T01329                                 

Gene name
XIAP
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:aml04120]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:aml04064]
Cellular Processes; Cell growth and death; Apoptosis [PATH:aml04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:aml04510]
Human Diseases; Cancers; Pathways in cancer [PATH:aml05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:aml05222]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:aml05166]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:aml05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 497 aa AA seqDB search
MTFNSFEGSKTCVPADIDKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAIDRWQYGDSAVGRHRKVSPNCRFINGFYFENAAAQPTNPGIQNGQYKTESY
LGNRNHFVLDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNIRSE
SDVVSSDRNFPNSTNVPRNPAMADYEARIITFGTWIYSVNKEQLARAGFYALGDGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEEKGQEYVSNIHLTHSFEDSMVRSAEKTP
SLTKRIDDAILQNPMLQEAIRMGFNFKDVKKIMEEKIQTSGSNYKSLEILVSDLVSAQKD
NTQDESSQTSLQKEISAEEQLRLLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacccgcagacatcgataaggat
gaagaatttgtagaagagtttaatagattaaaaacttttgctaatttcccaagtagtagt
cctgtttccgcatcaacgctagcacgagctggttttctatatactggtgaaggagacacc
gtgcgttgctttagttgtcatgcagcaatagatagatggcaatatggagactcggcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaatggcttttattttgaaaat
gctgctgcacaacctacaaatccgggtatccaaaatggtcagtataaaacggaaagctac
ctgggaaacagaaatcattttgttttagacaggccatccgagactcatgcagactatctt
ttgagaactggacaggtcgtagatatatccgacaccatatacccaaggaaccctgccatg
tatagtgaagaagctagattgaagtcatttcagaactggccagactatgcccacttgacc
ccaagagagttagctagtgctggactctactacacaggtattgatgatcaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgcgatcgtgcatggtcagaacac
aggcgacactttcctaactgcttctttgttctgggccggaatgttaacattcgaagtgaa
tctgatgtggtgagttctgataggaatttcccaaattcaacaaatgttccaagaaatcca
gccatggcagattatgaagcacggatcattacttttgggacgtggatatactcagttaac
aaggagcagcttgcgagagctggattttatgctttaggggatggtgataaagtaaaatgc
tttcattgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacat
gctaagtggtatccagggtgtaaatatctgttagaagagaagggacaagaatatgtaagc
aatattcatttaacccattcatttgaggactctatggtaagatctgctgaaaaaacacca
tcattaactaaaagaattgatgatgccatcttacaaaatcctatgttacaagaagctata
cgaatgggattcaatttcaaggacgttaagaaaataatggaggaaaaaattcagacatct
gggagcaactataaatcacttgagattctggtttcagatctagtgagtgctcagaaagac
aatacacaagatgaatcaagccagacttcattgcaaaaagagattagtgctgaagagcag
ctaaggctcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgcggtg
gttttcattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaa
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system