KEGG   Ailuropoda melanoleuca (giant panda): 100471214Help
Entry
100471214         CDS       T01329                                 

Definition
histone H2B type W-T-like
Orthology
K11252  
histone H2B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100471214
  Immune diseases
   05322 Systemic lupus erythematosus
    100471214
  Substance dependence
   05034 Alcoholism
    100471214
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100471214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 141 aa AA seqDB search
MAEPGCETSSEESLGTEEPSAANPKSPKQKQKQPRRQCRRRCRRCPNSFATYFPRVLKQV
HEGLSLSKKAVSVMDSFLKDIFEHIADEAAHLARSTKGSNKHSTINSREIQTAVRLLLPG
EIGKHTVSKATKAVIRFQRCE
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcctggctgtgagacctcttccgaggaaagcctgggcacggaggagccctcg
gcagccaacccgaagagcccgaagcagaagcagaagcagccgaggcgccaatgccgccgc
cgctgccgccgctgccccaacagtttcgccacctacttccccagggttctgaagcaggtg
cacgagggcctgagcctctcgaagaaggccgtgagtgtgatggattcgttccttaaggac
atcttcgagcacatcgctgacgaggccgctcacctggctcgctccaccaagggctccaac
aagcactccaccatcaactccagggagatccagacagccgtgcgcctgctgctgcccggg
gagatcggcaagcacaccgtgtccaaggccaccaaggccgtcatcaggttccagagatgc
gaatga

DBGET integrated database retrieval system