KEGG   Ailuropoda melanoleuca (giant panda): 100471214Help
Entry
100471214         CDS       T01329                                 

Definition
(RefSeq) late histone H2B.L4
  KO
K11252  
histone H2B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100471214
  Immune diseases
   05322 Systemic lupus erythematosus
    100471214
  Substance dependence
   05034 Alcoholism
    100471214
Chromosome [BR:aml03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100471214
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100471214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 141 aa AA seqDB search
MAEPGCETSSEESLGTEEPSAANPKSPKQKQKQPRRQCRRRCRRCPNSFATYFPRVLKQV
HEGLSLSKKAVSVMDSFLKDIFEHIADEAAHLARSTKGSNKHSTINSREIQTAVRLLLPG
EIGKHTVSKATKAVIRFQRCE
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcctggctgtgagacctcttccgaggaaagcctgggcacggaggagccctcg
gcagccaacccgaagagcccgaagcagaagcagaagcagccgaggcgccaatgccgccgc
cgctgccgccgctgccccaacagtttcgccacctacttccccagggttctgaagcaggtg
cacgagggcctgagcctctcgaagaaggccgtgagtgtgatggattcgttccttaaggac
atcttcgagcacatcgctgacgaggccgctcacctggctcgctccaccaagggctccaac
aagcactccaccatcaactccagggagatccagacagccgtgcgcctgctgctgcccggg
gagatcggcaagcacaccgtgtccaaggccaccaaggccgtcatcaggttccagagatgc
gaatga

DBGET integrated database retrieval system