KEGG   Ailuropoda melanoleuca (giant panda): 100471334Help
Entry
100471334         CDS       T01329                                 

Definition
early growth response protein 3-like
Orthology
K12497  
early growth response protein 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100471334
  Infectious diseases
   05161 Hepatitis B
    100471334
Transcription factors [BR:aml03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    100471334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 383 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPQGDVEAMYPALPPYSNCSDLYSEPVSFHDPQGNPGLAYSPQDYQSAKP
ALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHP
GFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDXRSDELTRHLRIHTGHKP
FQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEKKAE
KGGAPSASSAPPVSLAPVVTTCA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctctggcagcagc
gactcggtagcccattacaatcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaacccggaactctcttattcgggctccttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgtcaggac
aacatcattagcctcatgagcgccggcatcttgggggtgcccccggcctcaggggcactc
agcacgcagacctccacggccagcatggtgcagccgcagggcgacgtggaggccatgtat
ccggcgctgcccccctattctaactgcagtgatctctactcggagcctgtgtctttccac
gacccgcagggcaaccccgggctcgcctattccccccaggattaccaatcggccaagccg
gccttggacagcaatcttttccccatgattcctgactacaacctataccaccaccccaac
gatatgggctccattccggagcacaagcccttccagggcatggaccccatccgggtcaac
ccgccccctattaccccgctggagaccatcaaggcattcaaagacaagcagatccacccg
ggctttggcagcctgccccagccgccgctcacgctcaagcccatccggccccgcaagtat
cccaaccgacccagcaagaccccgctccacgagcggccccacgcgtgcccggcggagggc
tgcgacngccgctcggacgagctgacccggcacctgcgcatccacactggccacaagccc
ttccagtgccggatctgcatgcggagcttcagtcgcagcgaccaccttaccacccacatc
cgcacgcacacgggcgagaagccctttgcctgcgagttctgcgggcgcaagtttgcgcgc
agcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggagaagaaggcggag
aaggggggtgcgccctctgcgtcttcggcgccccccgtgtccctggcccctgtggtcacc
acctgcgcctga

DBGET integrated database retrieval system