KEGG   Ailuropoda melanoleuca (giant panda): 100471409Help
Entry
100471409         CDS       T01329                                 

Definition
stearoyl-CoA desaturase 5-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aml01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:aml01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:aml03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 347 aa AA seqDB search
MALTGVATPDSYFTFADASGLWLQKKNKSFQKGKEEIRARVEGSENGGGQQRPGAHRQRQ
NIVWRNVVLMSLLHLGAVYSLALIPAAAPLLLLWAYFCFLLTALGVTAGAHRLWSHRSYK
AKLPLRIFLAAANSMAFQNDIFEWARDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRK
HRDVIEKGSKLDFTDLLADPVVRFQRKYYKITVVLMCFMIPTLVPWCVWGESLWNSYFLA
SILRYTISLNITWLVNSAAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYS
ASEFGLNFNPTTWFIDLMCWLGLATDRKRATKPMIEARKAKTGDGST
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggccttaaccggtgttgccactccagacagctattttacattcgccgacgcgagtggc
ctgtggcttcaaaagaaaaacaagtcatttcaaaagggaaaggaggagatccgtgcgagg
gtcgaaggctcggagaacggcggcggccagcagagacccggcgcgcaccggcagcggcag
aacatcgtctggagaaacgtcgtcctgatgagtctgctccacttgggggccgtgtactcc
ctggcgctcattcctgcggctgcaccgctcctgcttctctgggcctacttctgcttcctc
ctgactgctctgggcgtgacagctggggcccatcgcttgtggagccacaggtcctacaag
gccaagctgcctctgaggatatttctggctgctgccaactccatggctttccagaatgac
atctttgagtgggccagggaccaccgagtccaccacaagtactcagagaccgatgctgac
cctcacaatgcccgccggggcttcttcttctcccatatcgggtggctgtttgttcgcaaa
catagagatgtcatcgagaaggggagcaagcttgacttcactgacctgctggctgatcct
gtggtccgattccagagaaagtattataagatcaccgtggtgctcatgtgcttcatgatc
cccacgctggtgccctggtgcgtctggggggagagtctctggaattcctacttcttggct
tccatcctccgctataccatctccctcaacatcacctggctggtcaacagtgctgcccac
atgtatggaaaccggccctacgacaagcacatcagccctcggcagaacccactcgtcact
ctgggtgccattggtgaaggcttccacaattaccaccacacctttccctttgactactcc
gcaagtgaatttggcttaaatttcaacccaaccacttggttcattgacctcatgtgttgg
ctggggctggccactgaccgcaaacgggcaaccaagccgatgatcgaggcccggaaagcc
aagactggagatggcagcacttga

DBGET integrated database retrieval system