KEGG   Ailuropoda melanoleuca (giant panda): 100471409Help
Entry
100471409         CDS       T01329                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100471409 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100471409 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100471409 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100471409 (SCD5)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100471409 (SCD5)
Lipid biosynthesis proteins [BR:aml01004]
 Desaturase
  First
   100471409 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 376 aa AA seqDB search
MLAIVITIIVIIVHADETQSHPSSLKRIRLASDSNLFIVTDSATCPSFGMDSPWGPKDLI
RRDEIPLSISCLGQSFQHCQEPNKITGYCSNAGLKQEGLERRKSFAGQSSQLTSNAVSPA
GNAAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQNDIFEWARDHRVH
HKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGSKLDFTDLLADPVVRFQRKYYKI
TVVLMCFMIPTLVPWCVWGESLWNSYFLASILRYTISLNITWLVNSAAHMYGNRPYDKHI
SPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDLMCWLGLATDRKRAT
KPMIEARKAKTGDGST
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgttggccattgtcatcaccatcatcgtcatcatcgttcatgcggatgaaacccagtct
cacccttccagcctcaagcgaatccgtctggcttctgacagcaacctgttcatcgtcaca
gactcggccacttgtccctcctttgggatggatagcccctggggccctaaggatctcatt
cgcagggatgaaatccccctcagtatttcttgcctgggccagagcttccagcactgccag
gagccaaacaaaatcactggctactgctcgaatgcaggattgaagcaggaaggactggag
aggagaaagtcctttgcgggccagagctcccaactgacttccaatgcagtctcgccggcg
ggcaacgcagcctacttctgcttcctcctgactgctctgggcgtgacagctggggcccat
cgcttgtggagccacaggtcctacaaggccaagctgcctctgaggatatttctggctgct
gccaactccatggctttccagaatgacatctttgagtgggccagggaccaccgagtccac
cacaagtactcagagaccgatgctgaccctcacaatgcccgccggggcttcttcttctcc
catatcgggtggctgtttgttcgcaaacatagagatgtcatcgagaaggggagcaagctt
gacttcactgacctgctggctgatcctgtggtccgattccagagaaagtattataagatc
accgtggtgctcatgtgcttcatgatccccacgctggtgccctggtgcgtctggggggag
agtctctggaattcctacttcttggcttccatcctccgctataccatctccctcaacatc
acctggctggtcaacagtgctgcccacatgtatggaaaccggccctacgacaagcacatc
agccctcggcagaacccactcgtcactctgggtgccattggtgaaggcttccacaattac
caccacacctttccctttgactactccgcaagtgaatttggcttaaatttcaacccaacc
acttggttcattgacctcatgtgttggctggggctggccactgaccgcaaacgggcaacc
aagccgatgatcgaggcccggaaagccaagactggagatggcagcacttga

DBGET integrated database retrieval system