KEGG   Ailuropoda melanoleuca (giant panda): 100471440Help
Entry
100471440         CDS       T01329                                 

Definition
6-phosphofructokinase, muscle type-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100471440
   01230 Biosynthesis of amino acids
    100471440
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100471440
   00030 Pentose phosphate pathway
    100471440
   00051 Fructose and mannose metabolism
    100471440
   00052 Galactose metabolism
    100471440
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100471440
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100471440
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100471440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 782 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIREASWESVSMMLQLGGTVIGSARCKDFRDREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMNDRRFDEAMKLRGRSFMNNWEVYKLLAHVRPPVTKAPGSTHTVAVMNVGAPAAGMNAA
VRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSF
EQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKLFDELCIPFVVIPATVSNNVPGSDF
SVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEE
PFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNV
LGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRAL
VFQPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGET
SI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggatcggcaaagccatcgccgtg
ttaacctcgggcggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatctttactggtgcccgtgtcttctttgtccatgagggttaccaaggcctggtggat
ggcggagatcacatcagggaggccagctgggagagcgtttcgatgatgctgcagctggga
ggcacagtcattggaagtgcccggtgcaaggacttccgggaccgagaggggcgactgcga
gccgcccacaacctggtgaagcgtgggattaccaatctgtgtgtcattgggggtgatggc
agcctcactggggctgacaccttccgttctgagtggagtgacttattgagtgacctccag
aaagcgggtaagatcacagcggaggaggctacaaagtccagctacctgaacatcgtgggc
ttggtgggctcaattgacaatgacttctgtggcaccgatatgaccatcggcactgattcc
gccctacaccggatcatagagatcgtggacgccatcaccactactgctcagagccaccag
aggacgtttgtgttagaagtgatgggccggcactgtggatacctggcccttgtcacctcc
ctctcctgtggggctgactgggtgtttattcctgaatgtccgccagatgatgactgggag
gaacatctttgtcgccggctcagcgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgcgatcgacaagaatgggaaaccaatcacctccgaggacatcaag
aacctggtggtaaagcgcctgggatatgacacccgggtcactgtcttggggcatgtgcag
cggggtgggacaccgtcagcctttgaccgaatcctgggcagcaggatgggtgtggaagcc
gtgatggcgcttttggaggggactccggacacccccgcctgtgtggtgagcctctctggt
aaccaggctgtgcgtctgcccctcatggagtgtgtccaggtgaccaaggatgtgaccaag
gccatgaacgacaggaggttcgatgaagccatgaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctggctcatgtcagacccccagtcacaaaggcaccgggt
agcacgcacacggtggccgtgatgaatgtgggggccccggctgcaggcatgaatgctgcc
gtgcgctcgactgtgagaattggcctcatccaaggcaaccgggtgctggttgtgcatgac
ggcttcgagggcctggccaagggtcagatcgaggaggctggctggagctatgtggggggc
tggactggccaaggaggttccaaacttgggactaaaaggactctccccaagaagagcttt
gagcagatcagtgccaacatcactaagtttaacatccagggccttgtcatcatcggtggc
tttgaggcttacacggggggcctggaactgatggagggcaggaagctgtttgacgagctg
tgcatcccgtttgtggtcatccccgctacggtctccaacaacgtccccggctcggacttc
agcgtgggggctgacacagccctcaacactatctgcacgacgtgtgaccgcatcaagcag
tcagcagcaggcaccaagcgtcgggtgttcatcattgagacgatgggcggctactgcggc
tacctggccaccatggcggggctggcagccggggctgatgctgcctacatttttgaggag
cccttcaccattcgggacctgcaggcaaatgttgaacatctggtgcaaaagatgaaaaca
actgtgaagaggggcttggtgttaaggaatgagaagtgcaatgagaattataccactgac
ttcattttcaacctgtactctgaggaggggaagggcatctttgacagcaggaagaatgtg
cttggccacatgcagcagggtggaagcccaactccatttgacaggaactttgccaccaag
atgggcgccaaggctatgaactggatgtccgggaaaatcaaagagagttaccgtaatggg
aggatctttgccaatacgccagactcgggctgtgttctggggatgcgtaagagggctctg
gtcttccaaccagtgactgagctgaaggaccagacggattttgagcaccgcatccccaag
gaacagtggtggctgaagctgaggcccatcctcaaaatcctagccaagtatgagattgac
ttggacacctccgagcatgcccacctggagcacatcagtcggaagcgatctggagaaact
tctatctaa

DBGET integrated database retrieval system