KEGG   Ailuropoda melanoleuca (giant panda): 100471440Help
Entry
100471440         CDS       T01329                                 

Definition
6-phosphofructokinase, muscle type-like
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100471440
   01230 Biosynthesis of amino acids
    100471440
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100471440
   00030 Pentose phosphate pathway
    100471440
   00051 Fructose and mannose metabolism
    100471440
   00052 Galactose metabolism
    100471440
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100471440
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100471440
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100471440
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100471440
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100471440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 782 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIREASWESVSMMLQLGGTVIGSARCKDFRDREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMNDRRFDEAMKLRGRSFMNNWEVYKLLAHVRPPVTKAPGSTHTVAVMNVGAPAAGMNAA
VRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSF
EQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKLFDELCIPFVVIPATVSNNVPGSDF
SVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEE
PFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNV
LGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRAL
VFQPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGET
SI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggatcggcaaagccatcgccgtg
ttaacctcgggcggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatctttactggtgcccgtgtcttctttgtccatgagggttaccaaggcctggtggat
ggcggagatcacatcagggaggccagctgggagagcgtttcgatgatgctgcagctggga
ggcacagtcattggaagtgcccggtgcaaggacttccgggaccgagaggggcgactgcga
gccgcccacaacctggtgaagcgtgggattaccaatctgtgtgtcattgggggtgatggc
agcctcactggggctgacaccttccgttctgagtggagtgacttattgagtgacctccag
aaagcgggtaagatcacagcggaggaggctacaaagtccagctacctgaacatcgtgggc
ttggtgggctcaattgacaatgacttctgtggcaccgatatgaccatcggcactgattcc
gccctacaccggatcatagagatcgtggacgccatcaccactactgctcagagccaccag
aggacgtttgtgttagaagtgatgggccggcactgtggatacctggcccttgtcacctcc
ctctcctgtggggctgactgggtgtttattcctgaatgtccgccagatgatgactgggag
gaacatctttgtcgccggctcagcgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgcgatcgacaagaatgggaaaccaatcacctccgaggacatcaag
aacctggtggtaaagcgcctgggatatgacacccgggtcactgtcttggggcatgtgcag
cggggtgggacaccgtcagcctttgaccgaatcctgggcagcaggatgggtgtggaagcc
gtgatggcgcttttggaggggactccggacacccccgcctgtgtggtgagcctctctggt
aaccaggctgtgcgtctgcccctcatggagtgtgtccaggtgaccaaggatgtgaccaag
gccatgaacgacaggaggttcgatgaagccatgaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctggctcatgtcagacccccagtcacaaaggcaccgggt
agcacgcacacggtggccgtgatgaatgtgggggccccggctgcaggcatgaatgctgcc
gtgcgctcgactgtgagaattggcctcatccaaggcaaccgggtgctggttgtgcatgac
ggcttcgagggcctggccaagggtcagatcgaggaggctggctggagctatgtggggggc
tggactggccaaggaggttccaaacttgggactaaaaggactctccccaagaagagcttt
gagcagatcagtgccaacatcactaagtttaacatccagggccttgtcatcatcggtggc
tttgaggcttacacggggggcctggaactgatggagggcaggaagctgtttgacgagctg
tgcatcccgtttgtggtcatccccgctacggtctccaacaacgtccccggctcggacttc
agcgtgggggctgacacagccctcaacactatctgcacgacgtgtgaccgcatcaagcag
tcagcagcaggcaccaagcgtcgggtgttcatcattgagacgatgggcggctactgcggc
tacctggccaccatggcggggctggcagccggggctgatgctgcctacatttttgaggag
cccttcaccattcgggacctgcaggcaaatgttgaacatctggtgcaaaagatgaaaaca
actgtgaagaggggcttggtgttaaggaatgagaagtgcaatgagaattataccactgac
ttcattttcaacctgtactctgaggaggggaagggcatctttgacagcaggaagaatgtg
cttggccacatgcagcagggtggaagcccaactccatttgacaggaactttgccaccaag
atgggcgccaaggctatgaactggatgtccgggaaaatcaaagagagttaccgtaatggg
aggatctttgccaatacgccagactcgggctgtgttctggggatgcgtaagagggctctg
gtcttccaaccagtgactgagctgaaggaccagacggattttgagcaccgcatccccaag
gaacagtggtggctgaagctgaggcccatcctcaaaatcctagccaagtatgagattgac
ttggacacctccgagcatgcccacctggagcacatcagtcggaagcgatctggagaaact
tctatctaa

DBGET integrated database retrieval system