KEGG   Ailuropoda melanoleuca (giant panda): 100471456Help
Entry
100471456         CDS       T01329                                 

Gene name
PPP1CB
Definition
(RefSeq) protein phosphatase 1, catalytic subunit, beta isozyme
  KO
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Insulin resistance
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100471456 (PPP1CB)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100471456 (PPP1CB)
   04024 cAMP signaling pathway
    100471456 (PPP1CB)
   04022 cGMP - PKG signaling pathway
    100471456 (PPP1CB)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100471456 (PPP1CB)
  Cell growth and death
   04114 Oocyte meiosis
    100471456 (PPP1CB)
  Cellular commiunity
   04510 Focal adhesion
    100471456 (PPP1CB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100471456 (PPP1CB)
  Endocrine system
   04910 Insulin signaling pathway
    100471456 (PPP1CB)
   04921 Oxytocin signaling pathway
    100471456 (PPP1CB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100471456 (PPP1CB)
   04270 Vascular smooth muscle contraction
    100471456 (PPP1CB)
  Nervous system
   04728 Dopaminergic synapse
    100471456 (PPP1CB)
   04720 Long-term potentiation
    100471456 (PPP1CB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100471456 (PPP1CB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100471456 (PPP1CB)
  Substance dependence
   05031 Amphetamine addiction
    100471456 (PPP1CB)
   05034 Alcoholism
    100471456 (PPP1CB)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100471456 (PPP1CB)
  Infectious diseases
   05168 Herpes simplex infection
    100471456 (PPP1CB)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100471456 (PPP1CB)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100471456 (PPP1CB)
Transcription machinery [BR:aml03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100471456 (PPP1CB)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100471456 (PPP1CB)
Spliceosome [BR:aml03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100471456 (PPP1CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 327 aa AA seqDB search
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKI
CGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQ
SMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEK
KAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcggacggggagctgaacgtggacagtctcatcacccgactgctggaggtacgagga
tgtcgcccaggaaagattgtgcagatgactgaagcagaagttcggggcttatgtatcaag
tctcgggagatctttcttagccagcctattcttttggagttggaagcaccgctgaaaatt
tgtggagatattcacggacagtatacagatttactgcgattatttgaatatggaggtttc
ccaccagaagccaactatcttttcttaggagattatgtggacagaggaaagcagtctttg
gaaaccatttgtttgctattggcttataaaatcaaatatccagagaacttctttctgtta
agaggaaaccatgagtgtgctagcatcaatcgcatttatgggttctatgatgaatgcaaa
cgaaggtttaatattaaattgtggaagaccttcaccgattgttttaattgtctgcctata
gctgccattgtggatgagaagatcttctgttgtcatggaggactatcaccagacctgcaa
tctatggagcagattcgaagaattatgagacccactgatgtccctgatacaggtttgctc
tgtgatttgctgtggtctgacccagataaggatgtgcaaggctggggagaaaatgatcgt
ggtgtttccttcacttttggagctgatgtagtcagtaaatttctgaatcgtcatgattta
gacttgatttgtcgagctcatcaggtggtagaagatggatatgaattttttgctaaacga
caattggtaaccctattttcagccccaaattactgtggcgagtttgataatgctggtgga
atgatgagtgtggatgaaactttgatgtgttcatttcagatattgaaaccatctgaaaag
aaagctaagtaccagtatggtggactgaattcaggacgtcctgtcactccacctcgaaca
gctaatccaccgaagaaaaggtga

DBGET integrated database retrieval system