KEGG   Ailuropoda melanoleuca (giant panda): 100471468Help
Entry
100471468         CDS       T01329                                 

Gene name
CPB1
Definition
(RefSeq) carboxypeptidase B1
  KO
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100471468 (CPB1)
   04974 Protein digestion and absorption
    100471468 (CPB1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     100471468 (CPB1)
Peptidases [BR:aml01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100471468 (CPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 417 aa AA seqDB search
MLAFLLLVTLALASAHHSGEHFEGEKVFRVNVEDENHITLLHKLASTTQIDFWKPDSVIQ
IKPHSTVDFRVKAEDIFTVEDFLEQNELQYEVLISNLRSALEGQFDSQVRATGHSYKKYN
RWKTIEAWTQQVTSENPDLISRSAIGTTFEGRTMYLLKVGKAGPNKPAIFMDCGFHAREW
ISPAFCQWFVREAIRTYGQEIQMTELLDKLDFYVLPVFNIDGYVYTWTKNRMWRKTRSTQ
AGTTCIGTDPNRNFDAGWCELGASRDPCDEIYCGPAAESEKETKAVANFIRSNLSSIKAY
LTIHSYSQMLLYPYSYDYKLTTNNAELNALAKATVKTLASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDKGRYGFTLPESQIQPTCEETMLAIKYLAEYVLEHLY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgttggcgttcttgcttcttgtgactctggccctagcatctgctcaccattctggtgag
cactttgaaggtgagaaggtgtttcgtgtcaatgttgaagatgaaaatcacatcacctta
cttcataagttggccagcaccacccagattgacttctggaaaccagattctgtcatacaa
atcaaacctcacagtacagttgacttccgtgttaaagcagaagatattttcactgtggaa
gattttctggagcagaatgaactacaatatgaggtattgataagcaacctgagatctgcg
ttggaaggtcagtttgacagccaggtccgtgcaactggacacagttataagaagtacaac
agatggaaaacgatagaggcttggactcaacaagtcaccagtgagaatccagacctcatc
tctcgcagtgccattggaaccacatttgaaggacgcactatgtacctcctcaaggttggc
aaagctggaccaaataagcctgccattttcatggactgtggtttccatgccagagaatgg
atttcccccgcattttgccaatggtttgtgagagaggctattcgcacctatggacaagag
atccaaatgacagaacttctcgacaagttagacttttatgtcttgcctgtgttcaatatc
gacggctacgtctacacctggaccaagaaccgaatgtggagaaagacccgctccacccag
gctggaactacctgcattggcacagaccccaacagaaattttgatgctggctggtgcgaa
ctcggagcttctcgagacccctgtgatgaaatttactgtggacctgctgcagagtccgaa
aaagagacaaaggccgtggctaatttcatccgcagcaacctctcttccatcaaagcatat
ctgacaatccactcatactcccaaatgctgctctacccttattcctatgattataaactc
acaacgaacaatgctgagttgaatgccctggctaaagctacagtaaaaacacttgccagc
ctgcatggcaccaagtacacatatggcccaggagctacaacaatctatcctgctgctggg
ggctctgatgactgggcttatgaccaaggaatcaaatactcctttacctttgaactccgg
gacaaaggcagatacggctttaccctccctgaatcccagattcagccaacctgtgaggag
acaatgctggccatcaagtaccttgccgaatatgtcctggaacatctgtactag

DBGET integrated database retrieval system