KEGG   Ailuropoda melanoleuca (giant panda): 100471564Help
Entry
100471564         CDS       T01329                                 

Definition
glutathione S-transferase-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100471564
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100471564
   00982 Drug metabolism - cytochrome P450
    100471564
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100471564
Enzymes [BR:aml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100471564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 189 aa AA seqDB search
MAGKPKLHYFSARGRMESIWRLLAAAGVEFEEELFETCEEFEKFKGGALMYEQVPMVVEI
DGMNLVETRAILRYLAAKYNLYGRNLQEQALRDHGQDFLVGDRLSWADVQLLEVIFMAEE
CKPSVLAGFPLLQEFKARISYIPTIRKFLQPGSQRKPPLDEGSIETMKNIFKFERGMFLK
NMGTIVAEY
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaagcccaagcttcattacttcagtgcacgaggcagaatggagtccatctgg
cggctcttggcggcagcaggagtagagtttgaagaagaactttttgaaacttgtgaagaa
tttgagaaatttaagggtggcgccctgatgtatgaacaagtacccatggtcgtcgaaatc
gatggaatgaatttggtagaaaccagagctatcctaagatacctagctgcaaaatacaac
ttgtatggaaggaacctgcaggaacaagcactaagagaccacgggcaagacttccttgtg
ggcgatcggctgagctgggctgatgtacagctccttgaagtcatcttcatggctgaagag
tgcaaacccagtgtcctcgcaggcttccctctgctacaggaattcaaggccagaatcagc
tacattcccacgattcgcaaatttctgcagcctggaagccaaaggaagcctccactagat
gaaggctccattgagaccatgaagaacatattcaaatttgaacgtggcatgtttctcaaa
aacatgggtacgatagtagctgagtattaa

DBGET integrated database retrieval system