KEGG   Ailuropoda melanoleuca (giant panda): 100471564Help
Entry
100471564         CDS       T01329                                 

Definition
(RefSeq) glutathione S-transferase-like
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100471564
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100471564
   00982 Drug metabolism - cytochrome P450
    100471564
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100471564
   05204 Chemical carcinogenesis
    100471564
   05225 Hepatocellular carcinoma
    100471564
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100471564
  Drug resistance
   01524 Platinum drug resistance
    100471564
Enzymes [BR:aml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100471564
Transporters [BR:aml02000]
 Other Transporters
  Pores ion channels [TC:1]
   100471564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 206 aa AA seqDB search
MLEVHHRLGEEKLESLSMAGKPKLHYFSARGRMESIWRLLAAAGVEFEEELFETCEEFEK
FKGGALMYEQVPMVVEIDGMNLVETRAISRYLAAKYNLYGRNLQEQALRDHGQDFLVGDR
LSWADVQLLEVIFMAEECKPSVLAGFPLLQEFKARISYIPTIRKFLQPGSQRKPPLDEGS
IETMKNIFKFERGMFLKNMGTIVAEY
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagttcatcaccggctaggggaggaaaagctggaatccttaagcatggcgggg
aagcccaagcttcattacttcagtgcacgaggcagaatggagtccatctggcggctcttg
gcggcagcaggagtagagtttgaagaagaactttttgaaacttgtgaagaatttgagaaa
tttaagggtggcgccctgatgtatgaacaagtacccatggtcgtcgaaatcgatggaatg
aatttggtagaaaccagagctatctccagatacctagctgcaaaatacaacttgtatgga
aggaacctgcaggaacaagcactaagagaccacgggcaagacttccttgtgggcgatcgg
ctgagctgggctgatgtacagctccttgaagtcatcttcatggctgaagagtgcaaaccc
agtgtcctcgcaggcttccctctgctacaggaattcaaggccagaatcagctacattccc
acgattcgcaaatttctgcagcctggaagccaaaggaagcctccactagatgaaggctcc
attgagaccatgaagaacatattcaaatttgaacgtggcatgtttctcaaaaacatgggt
acgatagtagctgagtattaa

DBGET integrated database retrieval system