KEGG   Ailuropoda melanoleuca (giant panda): 100471564Help
Entry
100471564         CDS       T01329                                 

Definition
(RefSeq) glutathione S-transferase-like
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100471564
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100471564
   00982 Drug metabolism - cytochrome P450
    100471564
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100471564
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100471564
  Drug resistance
   01524 Platinum drug resistance
    100471564
Enzymes [BR:aml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100471564
Transporters [BR:aml02000]
 Other Transporters
  Pores ion channels [TC:1]
   100471564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 206 aa AA seqDB search
MLEVHHRLGEEKLESLSMAGKPKLHYFSARGRMESIWRLLAAAGVEFEEELFETCEEFEK
FKGGALMYEQVPMVVEIDGMNLVETRAISRYLAAKYNLYGRNLQEQALRDHGQDFLVGDR
LSWADVQLLEVIFMAEECKPSVLAGFPLLQEFKARISYIPTIRKFLQPGSQRKPPLDEGS
IETMKNIFKFERGMFLKNMGTIVAEY
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctggaagttcatcaccggctaggggaggaaaagctggaatccttaagcatggcgggg
aagcccaagcttcattacttcagtgcacgaggcagaatggagtccatctggcggctcttg
gcggcagcaggagtagagtttgaagaagaactttttgaaacttgtgaagaatttgagaaa
tttaagggtggcgccctgatgtatgaacaagtacccatggtcgtcgaaatcgatggaatg
aatttggtagaaaccagagctatctccagatacctagctgcaaaatacaacttgtatgga
aggaacctgcaggaacaagcactaagagaccacgggcaagacttccttgtgggcgatcgg
ctgagctgggctgatgtacagctccttgaagtcatcttcatggctgaagagtgcaaaccc
agtgtcctcgcaggcttccctctgctacaggaattcaaggccagaatcagctacattccc
acgattcgcaaatttctgcagcctggaagccaaaggaagcctccactagatgaaggctcc
attgagaccatgaagaacatattcaaatttgaacgtggcatgtttctcaaaaacatgggt
acgatagtagctgagtattaa

DBGET integrated database retrieval system