KEGG   Ailuropoda melanoleuca (giant panda): 100471587Help
Entry
100471587         CDS       T01329                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Legionellosis
Class
Human Diseases; Infectious diseases; Legionellosis [PATH:aml05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 485 aa AA seqDB search
MMRHSKRTYCPDWDEKDWDCGKWRSSSSHKRKKRSHSSARENKHCKYNHSKTSDSHYLES
RSINEKDYHSRRYIDEYRNDYSQGCEPGHRHRDHESRYQNHSSKSSGRSGRSSYKSKHRI
HHSTSHHRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECI
DHKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPSSTFRCVQMLEWFEHHGHICI
VFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQS
DYTEAYNPKMKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQP
CDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDW
DEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIEKMLEYDPAKRITLKEALKHPFFYP
LKKAT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatgagacactcaaagagaacttactgtcctgattgggatgaaaaagattgggactgt
ggaaaatggagaagcagcagcagtcataaaagaaagaagagatcacatagcagtgcccgg
gagaacaagcactgcaaatataatcactctaaaacatctgatagccattatttggaaagc
agatcaataaatgagaaagattatcatagtcgacgctacattgatgaatacagaaatgac
tacagtcaaggatgtgaacctggacatcgccatagagaccatgaaagcagatatcagaac
catagtagcaagtcgtctgggagaagtggaagaagtagttataaaagcaaacacaggatt
caccacagtacttcacaccatcgttcacatgggaagagtcaccgaaggaaaagaaccagg
agtgtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgca
agatatgaaattgttgatactttaggagaaggagcttttggaaaagtcgtggagtgcatt
gatcataaagcaggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatac
tgtgaagctgctcgctcagaaatacaagttctggaacacttgaatacaacagaccccagt
agtacattccgctgtgtccagatgttggagtggtttgagcatcatggtcacatttgcatt
gtgtttgaactactaggacttagtacttatgacttcattaaggaaaatggttttctgcca
tttcgtctggatcatatcaggaagatggcatatcagatatgcaaatcagtgaattttctg
cacagtaacaagttgactcacacagacttaaagcctgaaaacatcttatttgtgcaatct
gactacacagaggcatataatcccaaaatgaaacgtgatgaacgtaccttaataaatcca
gatattaaagttgtagactttggaagtgcaacatatgatgatgaacatcacagtacattg
gtatctacaaggcattatagggcacctgaagttattttagccttaggatggtcccagcca
tgtgatgtctggagtataggttgtattcttattgaatactaccttgggtttacagtattt
ccaacacatgatagtaaggagcatttggcaatgatggaaaggattcttggacctttacca
aaacatatgatccagaaaaccaggaaacgtaaatatttccatcatgatcggttagactgg
gatgaacacagttctgctggcagatatgtttcaaggcgttgtaaacctctgaaggaattt
atgctctctcaggatgctgaacatgagcttctctttgacctcattgagaaaatgttggag
tatgacccagctaaaaggattactctcaaagaagccttaaagcatcctttcttttacccc
ttaaaaaaagctacatag

DBGET integrated database retrieval system