KEGG   Ailuropoda melanoleuca (giant panda): 100471587Help
Entry
100471587         CDS       T01329                                 

Gene name
CLK1
Definition
(RefSeq) CDC like kinase 1
  KO
K08823  CDC-like kinase [EC:2.7.12.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    100471587 (CLK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100471587 (CLK1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  CLK family
   100471587 (CLK1)
Spliceosome [BR:aml03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100471587 (CLK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 100471587
NCBI-ProteinID: XP_002915888
Ensembl: ENSAMEG00000005887
Position
Un
AA seq 485 aa AA seqDB search
MMRHSKRTYCPDWDEKDWDCGKWRSSSSHKRKKRSHSSARENKHCKYNHSKTSDSHYLES
RSINEKDYHSRRYIDEYRNDYSQGCEPGHRHRDHESRYQNHSSKSSGRSGRSSYKSKHRI
HHSTSHHRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECI
DHKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPSSTFRCVQMLEWFEHHGHICI
VFELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQS
DYTEAYNPKMKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQP
CDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDW
DEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIEKMLEYDPAKRITLKEALKHPFFYP
LKKAT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatgagacactcaaagagaacttactgtcctgattgggatgaaaaagattgggactgt
ggaaaatggagaagcagcagcagtcataaaagaaagaagagatcacatagcagtgcccgg
gagaacaagcactgcaaatataatcactctaaaacatctgatagccattatttggaaagc
agatcaataaatgagaaagattatcatagtcgacgctacattgatgaatacagaaatgac
tacagtcaaggatgtgaacctggacatcgccatagagaccatgaaagcagatatcagaac
catagtagcaagtcgtctgggagaagtggaagaagtagttataaaagcaaacacaggatt
caccacagtacttcacaccatcgttcacatgggaagagtcaccgaaggaaaagaaccagg
agtgtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgca
agatatgaaattgttgatactttaggagaaggagcttttggaaaagtcgtggagtgcatt
gatcataaagcaggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatac
tgtgaagctgctcgctcagaaatacaagttctggaacacttgaatacaacagaccccagt
agtacattccgctgtgtccagatgttggagtggtttgagcatcatggtcacatttgcatt
gtgtttgaactactaggacttagtacttatgacttcattaaggaaaatggttttctgcca
tttcgtctggatcatatcaggaagatggcatatcagatatgcaaatcagtgaattttctg
cacagtaacaagttgactcacacagacttaaagcctgaaaacatcttatttgtgcaatct
gactacacagaggcatataatcccaaaatgaaacgtgatgaacgtaccttaataaatcca
gatattaaagttgtagactttggaagtgcaacatatgatgatgaacatcacagtacattg
gtatctacaaggcattatagggcacctgaagttattttagccttaggatggtcccagcca
tgtgatgtctggagtataggttgtattcttattgaatactaccttgggtttacagtattt
ccaacacatgatagtaaggagcatttggcaatgatggaaaggattcttggacctttacca
aaacatatgatccagaaaaccaggaaacgtaaatatttccatcatgatcggttagactgg
gatgaacacagttctgctggcagatatgtttcaaggcgttgtaaacctctgaaggaattt
atgctctctcaggatgctgaacatgagcttctctttgacctcattgagaaaatgttggag
tatgacccagctaaaaggattactctcaaagaagccttaaagcatcctttcttttacccc
ttaaaaaaagctacatag

DBGET integrated database retrieval system