KEGG   Ailuropoda melanoleuca (giant panda): 100471588Help
Entry
100471588         CDS       T01329                                 

Definition
thrombospondin-4-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100471588
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100471588
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100471588
  Cellular commiunity
   04510 Focal adhesion
    100471588
 Human Diseases
  Infectious diseases
   05144 Malaria
    100471588
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100471588
  Exosomal proteins of colorectal cancer cells
   100471588
  Exosomal proteins of bladder cancer cells
   100471588
Heparan sulfate/heparin binding proteins [BR:aml00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100471588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 964 aa AA seqDB search
MLAPRGAVFLLLHLALQPWPGAGAQATPQVFDLLPSSSQRLNPAVLQPILTDPTLNEVYV
ISTFKLHTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLA
DGRRHRVLLRLSNLQRGAGSVELYVDCAQVDSVHNLPRAFSRSSQSPEPVELRTFQRKAQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLATTSTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETTFLRNTIAECQACGPLSFQSPTANTLVPPAPPAPATSPTPPVRRCDSNSCFR
GVRCTDTRDGFQCGPCPDGYTGNGITCSDIDECKYHPCYPGVRCVNLAPGFRCEACPVGF
TGPIVQAVGISFAKSNKQVCTDIDECRNGACVLNSICINTLGSYRCGPCKPGYTGDQTRG
CKTERSCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGRDVDIDSYPDEELPC
SARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNVDQRNSDKD
IFGDACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPKVPNRDQWDKDGDG
VGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKD
GIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICETDFDQDQVIDRID
VCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFN
GVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLK
AVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVR
FYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFD
HLDN
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgctggccccgcgcggagccgtcttcctcctgctgcacctggccctgcagccgtggccg
ggggccggagcccaagccaccccccaggtctttgaccttctcccatcctccagccagagg
ctgaacccagctgttctgcagccgatcctgacagaccccaccctgaatgaggtctacgtg
atctccaccttcaagctgcacactaaaagttcagccaccatctttggcctttactcttca
acggacaacagcaaatattttgaattcactgtgatgggacgcttgaacaaagccatcctc
cgttacctgaagaacgacgggaagattcacctggtggttttcaacaacttgcagctggct
gacggcaggcggcacagggtcctcctgagactgagcaacttgcagcgaggggcaggctcc
gtggagctctacgtggactgcgcccaggtggattctgtgcacaatctccccagagccttt
tcccgctcctcccagagtcccgagcccgtcgaattgaggactttccagaggaaggcacag
gacttcttggaagagctgaagctggtggtgagaggctcgctgttccaggtggccagcctg
caagactgcttcctgcagcagagtgagccactggccaccacaagcacaggagacttcaat
cggcagttcttggggcaaatgacacaactgaaccagctactgggagaggtgaaggatctt
ctgagacagcaggtcaaggaaacgacatttttgcgaaacactatagctgagtgccaggct
tgcggtccactcagctttcagtctccaaccgcaaacacactggtgcccccggcaccccca
gcgcccgcgacgtccccgacgccccccgtgcgccgctgtgattccaactcctgcttccgc
ggcgtccggtgtacggacaccagagacggcttccagtgtgggccctgccctgacggctac
acaggaaacgggatcacctgttctgatatcgatgagtgcaaataccatccctgctaccca
ggcgtgcgctgtgtgaacttggctcctggcttccggtgcgaggcctgccccgtgggcttc
accggccccatagtacaggctgttggcatcagttttgccaagtcaaacaagcaggtctgc
actgacattgatgagtgtcgaaatggagcatgtgttctcaattctatctgtattaacact
ttgggatcttaccgctgtgggccctgcaaaccagggtacacgggtgatcagacaagggga
tgcaaaactgaaagaagctgccgaaaccctgagctgaatccttgcagcgtgaacgcgcag
tgcatcgaagagaggcagggtgatgtgacgtgtgtgtgcggcgtcggctgggctggcgac
ggctacatctgcgggagggacgtggacatcgacagttaccctgacgaagaactgccgtgc
tctgccaggaactgcaagaaggacaactgcaagtatgtgccgaactctggccaggaagat
gcagacagagacggcattggggacgcttgtgatgaggatgctgatggagacgggatcctc
aatgagcaggataactgtgtcctgactcacaacgtggaccaaaggaacagcgacaaagat
atctttggggatgcctgtgataactgccggaatgtcctgaataatgaccagaaagacacc
gatggggatggaaaaggagatgcctgtgatgacgacatggacggagacggaataaaaaac
attctggacaactgccccaaagttcccaatcgtgaccaatgggacaaggatggggatggc
gtgggggatgcctgtgacagttgtcctgatgtcagcaaccctaaccagtctgatgtggat
aacgatctggttggggactcctgtgataccaatcaggacagtgatggagatgggcaccag
gacagcacagacaactgccccacagtcattaacagtgcccagctggacactgataaggat
gggattggtgacgagtgtgatgacgatgatgacaacgatggcatcccagacctggtgccc
cctggaccggacaactgccggctggtccccaacccagcccaggaggatagcaacagcgac
ggcgtgggagacatctgtgagacagactttgaccaggaccaggtcatcgatcggatcgac
gtctgcccggagaatgcagaggtcaccctgactgacttcagagcctaccagactgtggtc
ctggaccctgaaggagacgcccagatcgatcccaactgggtggtcctgaaccagggcatg
gagatcgtgcagaccatgaacagtgatcccggcctggcagtggggtacacggcgtttaac
ggagtggactttgaagggaccttccacgtgaacacccagacggacgatgactatgccggc
ttcatcttcggttaccaggacagctccagcttctacgtggtcatgtggaagcagacagag
cagacatactggcaagccacaccgttccgggctgtcgccgaacccggcatccagcttaag
gccgttaagtctaagactggtcccggggaacacctccgcaactccctgtggcacactggg
gacaccagcgaccaggtgcggctgctttggaaggactcaaggaacgtgggttggaaggac
aaggtctcctaccgctggttcctgcagcacaggccccaggtgggctacatcagagtgcga
ttttatgaaggctccgagttggtggccgactccggggtcaccatagacaccaccatgcgt
ggaggccggcttggcgtgttctgcttctcccaagaaaacatcatttggtccaacctcaag
tatcgctgcaatgacaccatcccagaggacttccaagagtttcaaacccagaacttcgat
cacctggataattaa

DBGET integrated database retrieval system