KEGG   Ailuropoda melanoleuca (giant panda): 100471588Help
Entry
100471588         CDS       T01329                                 

Gene name
THBS4
Definition
(RefSeq) thrombospondin 4
  KO
K04659  
thrombospondin 2/3/4/5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100471588 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100471588 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100471588 (THBS4)
  Cellular commiunity
   04510 Focal adhesion
    100471588 (THBS4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    100471588 (THBS4)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100471588 (THBS4)
  Exosomal proteins of colorectal cancer cells
   100471588 (THBS4)
  Exosomal proteins of bladder cancer cells
   100471588 (THBS4)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100471588 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 964 aa AA seqDB search
MLAPRGAVFLLLHLALQPWPGAGAQATPQVFDLLPSSSQRLNPAVLQPILTDPTLNEVYV
ISTFKLHTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLA
DGRRHRVLLRLSNLQRGAGSVELYVDCAQVDSVHNLPRAFSRSSQSPEPVELRTFQRKAQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLATTSTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETTFLRNTIAECQACGPLSFQSPTANTLVPPAPPAPATSPTPPVRRCDSNSCFR
GVRCTDTRDGFQCGPCPDGYTGNGITCSDIDECKYHPCYPGVRCVNLAPGFRCEACPVGF
TGPIVQAVGISFAKSNKQVCTDIDECRNGACVLNSICINTLGSYRCGPCKPGYTGDQTRG
CKTERSCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGRDVDIDSYPDEELPC
SARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNVDQRNSDKD
IFGDACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPKVPNRDQWDKDGDG
VGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKD
GIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICETDFDQDQVIDRID
VCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFN
GVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLK
AVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVR
FYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFD
HLDN
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgctggccccgcgcggagccgtcttcctcctgctgcacctggccctgcagccgtggccg
ggggccggagcccaagccaccccccaggtctttgaccttctcccatcctccagccagagg
ctgaacccagctgttctgcagccgatcctgacagaccccaccctgaatgaggtctacgtg
atctccaccttcaagctgcacactaaaagttcagccaccatctttggcctttactcttca
acggacaacagcaaatattttgaattcactgtgatgggacgcttgaacaaagccatcctc
cgttacctgaagaacgacgggaagattcacctggtggttttcaacaacttgcagctggct
gacggcaggcggcacagggtcctcctgagactgagcaacttgcagcgaggggcaggctcc
gtggagctctacgtggactgcgcccaggtggattctgtgcacaatctccccagagccttt
tcccgctcctcccagagtcccgagcccgtcgaattgaggactttccagaggaaggcacag
gacttcttggaagagctgaagctggtggtgagaggctcgctgttccaggtggccagcctg
caagactgcttcctgcagcagagtgagccactggccaccacaagcacaggagacttcaat
cggcagttcttggggcaaatgacacaactgaaccagctactgggagaggtgaaggatctt
ctgagacagcaggtcaaggaaacgacatttttgcgaaacactatagctgagtgccaggct
tgcggtccactcagctttcagtctccaaccgcaaacacactggtgcccccggcaccccca
gcgcccgcgacgtccccgacgccccccgtgcgccgctgtgattccaactcctgcttccgc
ggcgtccggtgtacggacaccagagacggcttccagtgtgggccctgccctgacggctac
acaggaaacgggatcacctgttctgatatcgatgagtgcaaataccatccctgctaccca
ggcgtgcgctgtgtgaacttggctcctggcttccggtgcgaggcctgccccgtgggcttc
accggccccatagtacaggctgttggcatcagttttgccaagtcaaacaagcaggtctgc
actgacattgatgagtgtcgaaatggagcatgtgttctcaattctatctgtattaacact
ttgggatcttaccgctgtgggccctgcaaaccagggtacacgggtgatcagacaagggga
tgcaaaactgaaagaagctgccgaaaccctgagctgaatccttgcagcgtgaacgcgcag
tgcatcgaagagaggcagggtgatgtgacgtgtgtgtgcggcgtcggctgggctggcgac
ggctacatctgcgggagggacgtggacatcgacagttaccctgacgaagaactgccgtgc
tctgccaggaactgcaagaaggacaactgcaagtatgtgccgaactctggccaggaagat
gcagacagagacggcattggggacgcttgtgatgaggatgctgatggagacgggatcctc
aatgagcaggataactgtgtcctgactcacaacgtggaccaaaggaacagcgacaaagat
atctttggggatgcctgtgataactgccggaatgtcctgaataatgaccagaaagacacc
gatggggatggaaaaggagatgcctgtgatgacgacatggacggagacggaataaaaaac
attctggacaactgccccaaagttcccaatcgtgaccaatgggacaaggatggggatggc
gtgggggatgcctgtgacagttgtcctgatgtcagcaaccctaaccagtctgatgtggat
aacgatctggttggggactcctgtgataccaatcaggacagtgatggagatgggcaccag
gacagcacagacaactgccccacagtcattaacagtgcccagctggacactgataaggat
gggattggtgacgagtgtgatgacgatgatgacaacgatggcatcccagacctggtgccc
cctggaccggacaactgccggctggtccccaacccagcccaggaggatagcaacagcgac
ggcgtgggagacatctgtgagacagactttgaccaggaccaggtcatcgatcggatcgac
gtctgcccggagaatgcagaggtcaccctgactgacttcagagcctaccagactgtggtc
ctggaccctgaaggagacgcccagatcgatcccaactgggtggtcctgaaccagggcatg
gagatcgtgcagaccatgaacagtgatcccggcctggcagtggggtacacggcgtttaac
ggagtggactttgaagggaccttccacgtgaacacccagacggacgatgactatgccggc
ttcatcttcggttaccaggacagctccagcttctacgtggtcatgtggaagcagacagag
cagacatactggcaagccacaccgttccgggctgtcgccgaacccggcatccagcttaag
gccgttaagtctaagactggtcccggggaacacctccgcaactccctgtggcacactggg
gacaccagcgaccaggtgcggctgctttggaaggactcaaggaacgtgggttggaaggac
aaggtctcctaccgctggttcctgcagcacaggccccaggtgggctacatcagagtgcga
ttttatgaaggctccgagttggtggccgactccggggtcaccatagacaccaccatgcgt
ggaggccggcttggcgtgttctgcttctcccaagaaaacatcatttggtccaacctcaag
tatcgctgcaatgacaccatcccagaggacttccaagagtttcaaacccagaacttcgat
cacctggataattaa

DBGET integrated database retrieval system