KEGG   Ailuropoda melanoleuca (giant panda): 100471717Help
Entry
100471717         CDS       T01329                                 

Definition
cytochrome P450 4X1-like
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100471717
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100471717
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP4 family
   100471717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 448 aa AA seqDB search
LLQDGKMEKFEEVVEKYHCAFPCWVGPFQAFFYIYDPDYAKTFLGRTDPKSKYLYKFLIP
CLGKGLLSLDGPKWFQHRRLLTPGFNVNILKSYVKVMAHSVNTMLGEWEKICSPQDTAVE
VYEHVNLMTLDILMKCAFSQETNCQISSTRDLYVKAMFEASKIIFYRSYSFLHHHDIIFK
FSPQGHRLQEMVKILHQYTEKVIQDRKKFLKDDKKHGNTQKQKYQDFLDIILSAQAENDN
SFSDTDLRSEVNTFMLAGHDTTAGSISWLLYHLALNPEHQERCREEIRGILGDGSSITWD
QLGEMAYTTMCIKESLRLAPPIPSISRELSKPITFPDGRSLPAGITVVLSIWGLHHNPAI
WENPKVFDPLRFSQENSEQRHPHSFLPFSAGPRNCIGQHFAMIELKVAIALILLRFKVAP
DPTRPLVFLHQIVLKAKDGVHLHLKKLS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttacttcaggatggtaaaatggagaaatttgaggaggttgtcgaaaaataccattgtgcc
tttccttgctgggttgggccttttcaggcatttttttatatctatgacccagactacgca
aagacatttctgggcagaacagatcccaagtccaagtacctgtacaagttcctgattccg
tgtcttggaaaaggactgctgagtctagacggacccaagtggttccagcaccgtcgccta
ctaactcctgggttcaatgttaacatcttgaaatcatatgtcaaggtgatggcccattct
gtgaacacaatgctgggtgagtgggagaagatttgcagccctcaggacacagctgtggag
gtctatgagcacgtcaacttgatgaccctggacatacttatgaaatgtgctttcagccag
gagaccaactgccagataagcagcacccgtgatctttatgttaaagcaatgtttgaagcc
agcaaaatcatcttttaccgctcatacagtttcttacatcaccatgacatcattttcaaa
ttcagccctcagggccaccgcttacaggagatggtcaaaattctacatcagtacacagaa
aaagtaatccaagatagaaagaaattcctcaaagacgacaagaagcatggtaacactcag
aagcagaagtaccaggattttctggatattatcctttctgcccaggctgaaaatgacaac
agcttctcagatactgacctaaggtctgaggtgaacacattcatgttggcagggcatgac
accacggcagggagcatttcctggctcctctaccacctggctctgaaccctgagcatcag
gagagatgccgggaagagatcaggggcatcctgggggacgggtcttctatcacctgggac
cagctgggtgagatggcatacaccacaatgtgcatcaaggagtcactccgactggcgcct
ccaatcccatccatttccagagagctcagcaagcccattaccttcccagatggacgctcc
ttgcctgcaggaataactgtggttctcagtatttggggccttcaccataaccctgccatc
tgggaaaatccaaaggtctttgaccccttgaggttctcccaggagaattctgagcagaga
cacccccactccttcttaccattctcagctggaccaagaaactgtatcgggcagcatttt
gccatgattgagctaaaggtggccattgccttgattctactccgcttcaaggtggctccg
gaccccaccagacctcttgtcttcttgcaccagattgtcctcaaagccaaggacggggtc
cacttgcacctgaagaaactctcctga

DBGET integrated database retrieval system