KEGG   Ailuropoda melanoleuca (giant panda): 100471721Help
Entry
100471721         CDS       T01329                                 

Gene name
ITGB6
Definition
integrin, beta 6
Orthology
K06589  
integrin beta 6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:aml04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:aml04512]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:aml04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:aml04510]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:aml05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:aml05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:aml05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 808 aa AA seqDB search
MKTFKFTSQVSFQSSRELKRMGTELLCLFFLFLGRTDHVQGGCAMGGAETCEDCLLIGPQ
CAWCSQENFTHPSGVGERCDTPATLLAKGCQLTFIENPVSQVEIHTNKPLSVGRQKNSSD
IVQIAPQKLTLKLRPGSEQTLQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLS
KEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDA
ERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDS
KLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYEN
YAKLIPGATVGVLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTATCNNGVLF
PQQKKCSHMKVGDTASFNVTVSIPNCERRSRHIIIKPVGLGDALEILVSPECNCDCQKEV
EVNSSKCHNGNGSFQCGVCACNPGHMGPRCECGEDTLSTDSCKEAPDHPSCSGRGDCYCG
QCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGDNGVCDCGECVCRPGWAGEYCNCTTST
DSCVSEDGVLCSGRGDCICGTCACTNPGASGPTCERCPTCGDPCNSKRSCIECHLSADGQ
AQEECVDKCKLAGATISEAEDFSKDSSVPCSLQGENECLITFLITTDNEGKSIIHSISEK
DCAKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNP
LYRGSTSTFKNVTYKHREKQKMDLSTDG
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttttaaatttacatctcaagtttctttccaaagcagtcgagaactgaaacga
atggggactgaactgctttgcctgttctttctatttctaggaaggactgatcacgtacaa
ggcggctgtgccatgggaggtgcagagacctgtgaagactgcttactcattggacctcag
tgtgcctggtgctctcaggagaattttacccatccatctggagttggagaaaggtgtgat
accccagcaactcttttagctaaaggatgccaactaactttcatcgaaaaccctgtctcc
caagtagaaatacatacaaataagcctctcagtgtaggcagacagaaaaatagttctgac
attgttcagattgcgcctcaaaagttgactcttaaattgagaccaggcagtgaacagact
ctgcaagtgcaagtccgccagacggaggattacccggtggacttgtattacctcatggac
ctctcagcctccatggatgatgacctcaacacaatcaaggagctgggctccctgctttcc
aaggagatgtctaaattaaccagcaactttagactgggcttcggctcttttgtggaaaaa
cctgtctccccttttgtgaaaacaacaccagaagaaatcgccaacccttgcagtagtatt
ccatacttctgcttacctacatttggattcaagcacattttgccattgacgaatgatgct
gaacgattcaatgaaattgtgaagaatcagaaaatttctgctaatattgacacaccagaa
ggtggatttgatgcaattatgcaagctgctgtgtgtaaggaaaagattggctggcggaat
gattccctccatctcctggtctttgtgagtgatgccgattctcattttggaatggatagc
aaactggcaggcattgtcattcctaacgatggtctctgtcacttggacagcaagaatgag
tactccatgtcaactgtcttggaatatccaacaattggacaactcattgataaactggtg
caaaataacgtgctattaatctttgctgtaacccaagaacaagttcatctatatgagaat
tatgcaaaactcattcctggagctacagtaggggtacttcaaaaggactccggaaacatt
ctccagctgatcatctcggcttatgaagaactgcggtctgaggtggaacttgaagtgtta
ggagacacggaaggactcaacctatctttcacggctacctgtaacaacggggtcctcttc
ccacaacaaaagaaatgctctcacatgaaggtgggagacacagcttcatttaacgtgacc
gtgagtatacccaactgtgagagaagaagcaggcacattatcataaagcctgtggggctg
ggggacgccctagaaatacttgtcagtccggaatgcaactgtgactgtcagaaagaagtg
gaagtgaacagctccaaatgtcacaacgggaacggttccttccagtgtggggtgtgtgcc
tgcaaccccggccacatgggtcctcgctgtgagtgtggggaggacacactcagcacggat
tcctgcaaggaggccccggatcacccctcatgcagtggaagaggcgattgctactgtggg
cagtgcatctgccacttgtctccctatggaaacatttatgggccttactgccagtgtgac
aacttctcctgcgtgaggcacaaagggctgctctgcggagataacggcgtgtgtgactgc
ggtgaatgcgtgtgcaggcccggctgggcaggcgagtactgtaactgcaccaccagcacg
gactcctgcgtctctgaggatggggtgctctgtagcgggcgaggggactgcatctgtggc
acgtgtgcttgcacgaacccaggagcctctggaccgacctgtgaacgttgtcctacctgt
ggtgatccctgtaactctaaacggagctgcattgaatgccacctgtctgcagatggtcag
gcccaagaagaatgtgttgacaaatgcaaactagctggtgcgaccatcagtgaagcagaa
gatttttcaaaggatagttctgttccctgttctctgcaaggagaaaatgaatgtcttatt
acattcctaataactacagataatgaagggaaaagcatcattcacagcatcagtgagaaa
gactgtgcaaagcccccaaatattcccatgatcatgttgggggtttcactggctattctt
ctcattggggtcgttctattgtgcatttggaagctgctggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaagcagaacggtcgaaggccaagtggcaaacgggaaccaatcca
ttatacagaggctctaccagtacctttaaaaatgtaacctataaacacagggaaaaacaa
aagatggacctttccacggatggatag

DBGET integrated database retrieval system