KEGG   Ailuropoda melanoleuca (giant panda): 100471908Help
Entry
100471908         CDS       T01329                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04915  Estrogen signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05200  Pathways in cancer
aml05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100471908 (NCOA1)
   04919 Thyroid hormone signaling pathway
    100471908 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100471908 (NCOA1)
   05224 Breast cancer
    100471908 (NCOA1)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100471908 (NCOA1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100471908 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 100471908
NCBI-ProteinID: XP_002913840
Ensembl: ENSAMEG00000002653
UniProt: D2GXQ2
Position
Un
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNSSISPAHGVARSSTLPPSSNNMVSPRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLAPRPRMPNNSFPPNIPTLSSPVGMTGTACNNSNRSYSNIPVTS
LQSMNEGPNNSVGFSSSSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
SGTSSSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSVKLELEASKKKESKDHQLLRYLLDKDEKDVRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPVTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCEPERMDGAV
TNVTIKSETLPASLQSTTARPTSRMNRLPELELEAIDNQFGQPGTGDQIPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
LPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPESTLAN
RNSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGETNFAPSLSPGSSMVPMPI
PPPQSSLLQPTPPSSGYQSPDMKAWQQGAMGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
TDGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcaccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagagctagctgagttactgtctgccaacatcagtgacattgacagtttg
agtgtaaagccagacaaatgcaagattttgaagaagacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatccacaactgatgatgaagtgcagaagtcagacatctca
tccagcagtcagggggtgatagaaaaggaatccctgggacctcttctgttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatattg
catgtgggggatcatgcggaatttgtgaagaatctgctcccaaaatcactagtaaatgga
gttccttggcctcaggaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcaccgagaaccaagaagcttgccagcggtatgaagtc
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgcctgatttgtattgcacggcgattacctcggcctccagccattacaggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggctgggaagatttggtgaggaagtgcatttatgctttcttc
caacctcagggcagagaaccatcttatgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctccgtcaattctagtatctcgccagctcatggtgtg
gcccgttcatccacattgccaccatccagcaacaacatggtatcccccagagtaaaccgc
caacagagctcagacctccatagcagcagtcatagtaattctagcaacagccaagggagt
tttggatgttcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaacccctctttaaacctcaataattctcctatggaaggtacagga
atatctctcgcacagttcatgtctccgaggagacaggttagttctggattggcaccaagg
cccaggatgccaaacaattcgttccctcctaatattccgacattaagctcccccgttggc
atgacaggtactgcctgtaataatagtaaccgctcttattcaaacatcccagtaacatct
ttacagagcatgaatgaaggacccaataactccgttggcttctcctccagttctcccgtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgacaac
agctctagtgatggcaaacctctggattctgggcttctgcacaacaatgacagactctca
gatggagacaataaatactctcaaaccagtcacaaacttgtgcagcttctgacaaccact
gcagagcagcagttacggcacgctgatatagacacaagttgcaaagaggtactgtcttgc
tcaggcacttccagctctgcctctgctaactcttcaagcggttcttgcccctcctctcac
agctctctgacagagcggcacaaaattctgcaccggctcctacaggagggtagcccctcg
gatatcaccactttgtctgttgagcctgataaaaaggacagtgcatctacttctgtatcg
gtgactggacaggtacaggggaactcaagtgtaaaactagaactggaggcttcaaagaaa
aaagaatcaaaagaccatcagctcctacggtatcttttagataaagatgagaaagatgta
agatcaactccgaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaacag
atggatccttgtaacacaaacccaactccagtgaccaaacctgctcctgaagaaattaaa
ctggagtcccagagccagtttacagctgaccttgaccagtttgatcagttactacccacg
ctggagaaggcagcccagttgccaggcttatgcgagccagagaggatggatggtgcggtc
accaatgtaaccatcaaatcggagaccctgccagcttcacttcagtccaccactgccaga
cccacttccaggatgaataggttaccggagctggaattggaagcaattgataaccagttt
ggacagccaggaacaggtgatcagattccatgggcaaataatacagtgactgctgtaaat
cagaataagccagaagaccagtgtattagttcacaattagatgagcttctctgtccacca
acaacagtagaaggaagaaatgatgagaaggctcttcttgaacagctagtgtccttcctc
agcggcaaagatgaaactgagctagctgaactagatagagctctgggaattgacaaactc
gtccagggaggtggattagatgtcttatcagagagatttccaccacaacaagcaacacca
cctttgatgatggaagaaagacccaacctttattcccagccttattcttctccttcacct
actgccaatctttctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
ctgcctgtccaagtgacacctccccgaggcgctttttcacctggcatgggcatgcagccc
cggcagactctgaacagacctccagccgcgcccaaccagctgcggcttcagcttcagcag
cgcttgcaggggcaacagcagttgatccaccaaaatcggcaagccatcttgaaccagttt
gcagcaaacgctcccgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaacgcccaaatgttggcacagcgtcagcgggagttgtacagccaacag
caccgacagaggcagctaatacagcagcaaagagccatgctcatgaggcaacaaagcttt
gggaacaacctccctccctcatctggactgccagttcagatggggaacccccgtcttcct
cagggtgctccgcagcaatttccctacccaccaaactatggtacaaatccaggaacccca
cctgcttcaaccagcccgttttcacaactggcagcaaatcctgagtcaaccttggccaac
cgcaacagcatggtaaacagaggcatgacaggaaacatgggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggatcaggaatggttccccaa
ggtgagaccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagccaactccaccctcttctgggtaccagtcacca
gacatgaaggcctggcagcaaggtgcaatgggaaacaacaatgtgttcagtcaagctgtc
cagaaccagcccacacctgcgcagccaggagtgtacaacaatatgagcatcaccgtgtcc
atggcaggtggaaacacaaatgttcagaacatgaacccaatgatgggccagatgcagatg
agctctttgcagatgccgggaatgaacactgtgtgccccgagcagataaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
acagacggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaaccc
acggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system