KEGG   Ailuropoda melanoleuca (giant panda): 100471908Help
Entry
100471908         CDS       T01329                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100471908 (NCOA1)
Enzymes [BR:aml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100471908 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNSSISPAHGVARSSTLPPSSNNMVSPRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLAPRPRMPNNSFPPNIPTLSSPVGMTGTACNNSNRSYSNIPVTS
LQSMNEGPNNSVGFSSSSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
SGTSSSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSVKLELEASKKKESKDHQLLRYLLDKDEKDVRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPVTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCEPERMDGAV
TNVTIKSETLPASLQSTTARPTSRMNRLPELELEAIDNQFGQPGTGDQIPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
LPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPESTLAN
RNSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGETNFAPSLSPGSSMVPMPI
PPPQSSLLQPTPPSSGYQSPDMKAWQQGAMGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
TDGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcaccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagagctagctgagttactgtctgccaacatcagtgacattgacagtttg
agtgtaaagccagacaaatgcaagattttgaagaagacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatccacaactgatgatgaagtgcagaagtcagacatctca
tccagcagtcagggggtgatagaaaaggaatccctgggacctcttctgttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatattg
catgtgggggatcatgcggaatttgtgaagaatctgctcccaaaatcactagtaaatgga
gttccttggcctcaggaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcaccgagaaccaagaagcttgccagcggtatgaagtc
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgcctgatttgtattgcacggcgattacctcggcctccagccattacaggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggctgggaagatttggtgaggaagtgcatttatgctttcttc
caacctcagggcagagaaccatcttatgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctccgtcaattctagtatctcgccagctcatggtgtg
gcccgttcatccacattgccaccatccagcaacaacatggtatcccccagagtaaaccgc
caacagagctcagacctccatagcagcagtcatagtaattctagcaacagccaagggagt
tttggatgttcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaacccctctttaaacctcaataattctcctatggaaggtacagga
atatctctcgcacagttcatgtctccgaggagacaggttagttctggattggcaccaagg
cccaggatgccaaacaattcgttccctcctaatattccgacattaagctcccccgttggc
atgacaggtactgcctgtaataatagtaaccgctcttattcaaacatcccagtaacatct
ttacagagcatgaatgaaggacccaataactccgttggcttctcctccagttctcccgtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgacaac
agctctagtgatggcaaacctctggattctgggcttctgcacaacaatgacagactctca
gatggagacaataaatactctcaaaccagtcacaaacttgtgcagcttctgacaaccact
gcagagcagcagttacggcacgctgatatagacacaagttgcaaagaggtactgtcttgc
tcaggcacttccagctctgcctctgctaactcttcaagcggttcttgcccctcctctcac
agctctctgacagagcggcacaaaattctgcaccggctcctacaggagggtagcccctcg
gatatcaccactttgtctgttgagcctgataaaaaggacagtgcatctacttctgtatcg
gtgactggacaggtacaggggaactcaagtgtaaaactagaactggaggcttcaaagaaa
aaagaatcaaaagaccatcagctcctacggtatcttttagataaagatgagaaagatgta
agatcaactccgaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaacag
atggatccttgtaacacaaacccaactccagtgaccaaacctgctcctgaagaaattaaa
ctggagtcccagagccagtttacagctgaccttgaccagtttgatcagttactacccacg
ctggagaaggcagcccagttgccaggcttatgcgagccagagaggatggatggtgcggtc
accaatgtaaccatcaaatcggagaccctgccagcttcacttcagtccaccactgccaga
cccacttccaggatgaataggttaccggagctggaattggaagcaattgataaccagttt
ggacagccaggaacaggtgatcagattccatgggcaaataatacagtgactgctgtaaat
cagaataagccagaagaccagtgtattagttcacaattagatgagcttctctgtccacca
acaacagtagaaggaagaaatgatgagaaggctcttcttgaacagctagtgtccttcctc
agcggcaaagatgaaactgagctagctgaactagatagagctctgggaattgacaaactc
gtccagggaggtggattagatgtcttatcagagagatttccaccacaacaagcaacacca
cctttgatgatggaagaaagacccaacctttattcccagccttattcttctccttcacct
actgccaatctttctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
ctgcctgtccaagtgacacctccccgaggcgctttttcacctggcatgggcatgcagccc
cggcagactctgaacagacctccagccgcgcccaaccagctgcggcttcagcttcagcag
cgcttgcaggggcaacagcagttgatccaccaaaatcggcaagccatcttgaaccagttt
gcagcaaacgctcccgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaacgcccaaatgttggcacagcgtcagcgggagttgtacagccaacag
caccgacagaggcagctaatacagcagcaaagagccatgctcatgaggcaacaaagcttt
gggaacaacctccctccctcatctggactgccagttcagatggggaacccccgtcttcct
cagggtgctccgcagcaatttccctacccaccaaactatggtacaaatccaggaacccca
cctgcttcaaccagcccgttttcacaactggcagcaaatcctgagtcaaccttggccaac
cgcaacagcatggtaaacagaggcatgacaggaaacatgggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggatcaggaatggttccccaa
ggtgagaccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagccaactccaccctcttctgggtaccagtcacca
gacatgaaggcctggcagcaaggtgcaatgggaaacaacaatgtgttcagtcaagctgtc
cagaaccagcccacacctgcgcagccaggagtgtacaacaatatgagcatcaccgtgtcc
atggcaggtggaaacacaaatgttcagaacatgaacccaatgatgggccagatgcagatg
agctctttgcagatgccgggaatgaacactgtgtgccccgagcagataaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
acagacggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaaccc
acggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system