KEGG   Ailuropoda melanoleuca (giant panda): 100472056Help
Entry
100472056         CDS       T01329                                 

Definition
(RefSeq) cytochrome P450 2E1
  KO
K07415  
cytochrome P450, family 2, subfamily E, polypeptide 1 [EC:1.14.13.-]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100472056
   00590 Arachidonic acid metabolism
    100472056
   00591 Linoleic acid metabolism
    100472056
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100472056
   00982 Drug metabolism - cytochrome P450
    100472056
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100472056
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100472056
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     100472056
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP2 family
   100472056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 494 aa AA seqDB search
MAALGITVALLVWAATLTLISVWKQIYSSWNLPPGPFPLPIIGNLLQLDLKNFPKSLTKL
AERYGPVFTLYLGSQRTVVLHGYKAVKEALLDHKNDLSGRGEIFAFQFHKDRGITFNNGP
GWKDTRRLSLTTLRDYGMGKRGNEERIRREIPFLLEALKGTQGQPFDPTFLLGFAPCNVI
ADILFRKHFDYTDETGLRIQRLFNENFHLLSTGWLQLYNIFPSCLQYLPGSHRKVLKNVS
EIKDYTSERVKEHQQSLDPNCLRDFTDCLLLELQKGRYSSEPWYTLDNIAVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRLEMPYMDAVVHEIQRF
IDLLPSNLPHEANQDTVFRGYVIPKGTVVIPTLDSLLFDKQEFPDPEKFKPEHFLNENGK
FKYSDYFKAFSAGKRVCVGEGLARMELFLFLSAVLQHFNLKSLVDPKDIDLSPIVIGFAK
IPPHYKLRVIPRSG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctgccttgggcatcacagttgccctgctggtgtgggcagccaccctgacgctgatc
tctgtctggaagcagatctacagcagctggaacctgccccctggcccttttccactgccc
attattgggaatcttcttcagttggatttgaagaattttcccaagtctctcaccaagctg
gcagagcggtatggaccagtgttcaccttgtacctgggctcccagcgcaccgtggtcctg
catggctacaaggcagtgaaggaagccctgcttgaccacaagaacgacctttctggcaga
ggagaaatctttgcattccagtttcacaaggacagagggattactttcaacaatggaccg
ggctggaaggacacccggcgactctccctgaccaccctccgggactatggcatggggaag
cgtggcaacgaggagcggatccggagggagatccccttcctgctggaagctctcaagggc
acccagggccagcccttcgaccccacatttctcctgggctttgccccctgcaacgtcatc
gctgacatcctcttccgcaagcactttgactacacggatgagacgggtctgaggatacag
aggcttttcaacgagaacttccacctgctcagcacaggctggctccaactttataacatt
ttcccaagctgtctgcagtacttgcctggaagccatcgaaaagtattaaaaaacgtgtct
gaaataaaagattacacttcagaaagagtgaaggagcaccagcagtcattggaccccaac
tgcctccgggacttcactgactgcctgctcctggagttgcagaagggaaggtacagttcc
gagccttggtacaccttggacaacattgctgtgaccgtggctgacctgttctttgctggt
acagagaccacaagcaccactctgagatatgggctcctgattctcatgaaatacccagag
atcgaagagaaacttcatgaagaaatcgacagggtgattgggccaagccgaatccccgcc
atcaaggacaggctagagatgccctatatggacgccgtggtgcacgagattcagcgattc
atcgacctcctgccctccaacctgccccatgaagccaaccaggacactgtgttcagaggc
tacgtcatccccaagggcacagttgtaattccaacactggactccctcctgtttgacaaa
caagaattccccgacccagagaagtttaagccagagcactttctgaatgaaaatggaaag
ttcaaatacagtgactatttcaaggcgttttccgcaggaaagcgggtgtgtgttggagaa
ggcctggcccgcatggaactgttcctgttcttgtctgctgtcctgcagcactttaacctg
aagtctcttgttgaccccaaggatattgacctcagtccaatcgtaatcgggtttgccaag
atcccaccccattacaaactccgtgtcattccccgctcgggctga

DBGET integrated database retrieval system