KEGG   Ailuropoda melanoleuca (giant panda): 100472056Help
Entry
100472056         CDS       T01329                                 

Definition
(RefSeq) cytochrome P450 2E1
  KO
K07415  cytochrome P450 family 2 subfamily E polypeptide 1 [EC:1.14.13.-]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00140  Steroid hormone biosynthesis
aml00590  Arachidonic acid metabolism
aml00591  Linoleic acid metabolism
aml00980  Metabolism of xenobiotics by cytochrome P450
aml00982  Drug metabolism - cytochrome P450
aml00983  Drug metabolism - other enzymes
aml01100  Metabolic pathways
aml04932  Non-alcoholic fatty liver disease (NAFLD)
aml05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100472056
   00590 Arachidonic acid metabolism
    100472056
   00591 Linoleic acid metabolism
    100472056
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100472056
   00982 Drug metabolism - cytochrome P450
    100472056
   00983 Drug metabolism - other enzymes
    100472056
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100472056
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100472056
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     100472056
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP2 family
   100472056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100472056
NCBI-ProteinID: XP_002928755
Ensembl: ENSAMEG00000003132
UniProt: G1L8V2
Position
Un
AA seq 494 aa AA seqDB search
MAALGITVALLVWAATLTLISVWKQIYSSWNLPPGPFPLPIIGNLLQLDLKNFPKSLTKL
AERYGPVFTLYLGSQRTVVLHGYKAVKEALLDHKNDLSGRGEIFAFQFHKDRGITFNNGP
GWKDTRRLSLTTLRDYGMGKRGNEERIRREIPFLLEALKGTQGQPFDPTFLLGFAPCNVI
ADILFRKHFDYTDETGLRIQRLFNENFHLLSTGWLQLYNIFPSCLQYLPGSHRKVLKNVS
EIKDYTSERVKEHQQSLDPNCLRDFTDCLLLELQKGRYSSEPWYTLDNIAVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRLEMPYMDAVVHEIQRF
IDLLPSNLPHEANQDTVFRGYVIPKGTVVIPTLDSLLFDKQEFPDPEKFKPEHFLNENGK
FKYSDYFKAFSAGKRVCVGEGLARMELFLFLSAVLQHFNLKSLVDPKDIDLSPIVIGFAK
IPPHYKLRVIPRSG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggctgccttgggcatcacagttgccctgctggtgtgggcagccaccctgacgctgatc
tctgtctggaagcagatctacagcagctggaacctgccccctggcccttttccactgccc
attattgggaatcttcttcagttggatttgaagaattttcccaagtctctcaccaagctg
gcagagcggtatggaccagtgttcaccttgtacctgggctcccagcgcaccgtggtcctg
catggctacaaggcagtgaaggaagccctgcttgaccacaagaacgacctttctggcaga
ggagaaatctttgcattccagtttcacaaggacagagggattactttcaacaatggaccg
ggctggaaggacacccggcgactctccctgaccaccctccgggactatggcatggggaag
cgtggcaacgaggagcggatccggagggagatccccttcctgctggaagctctcaagggc
acccagggccagcccttcgaccccacatttctcctgggctttgccccctgcaacgtcatc
gctgacatcctcttccgcaagcactttgactacacggatgagacgggtctgaggatacag
aggcttttcaacgagaacttccacctgctcagcacaggctggctccaactttataacatt
ttcccaagctgtctgcagtacttgcctggaagccatcgaaaagtattaaaaaacgtgtct
gaaataaaagattacacttcagaaagagtgaaggagcaccagcagtcattggaccccaac
tgcctccgggacttcactgactgcctgctcctggagttgcagaagggaaggtacagttcc
gagccttggtacaccttggacaacattgctgtgaccgtggctgacctgttctttgctggt
acagagaccacaagcaccactctgagatatgggctcctgattctcatgaaatacccagag
atcgaagagaaacttcatgaagaaatcgacagggtgattgggccaagccgaatccccgcc
atcaaggacaggctagagatgccctatatggacgccgtggtgcacgagattcagcgattc
atcgacctcctgccctccaacctgccccatgaagccaaccaggacactgtgttcagaggc
tacgtcatccccaagggcacagttgtaattccaacactggactccctcctgtttgacaaa
caagaattccccgacccagagaagtttaagccagagcactttctgaatgaaaatggaaag
ttcaaatacagtgactatttcaaggcgttttccgcaggaaagcgggtgtgtgttggagaa
ggcctggcccgcatggaactgttcctgttcttgtctgctgtcctgcagcactttaacctg
aagtctcttgttgaccccaaggatattgacctcagtccaatcgtaatcgggtttgccaag
atcccaccccattacaaactccgtgtcattccccgctcgggctga

DBGET integrated database retrieval system