KEGG   Ailuropoda melanoleuca (giant panda): 100472307Help
Entry
100472307         CDS       T01329                                 

Gene name
UNC13B
Definition
(RefSeq) unc-13 homolog B (C. elegans)
  KO
K15293  
protein unc-13
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:aml00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100472307 (UNC13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1603 aa AA seqDB search
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTVRQSDEEGPGEWSTLEAETLMKDDEICGTKNPTPHK
ILLDTRFELPFDIPEEEARYWTYKLEQINVLGADSEYSSQEESRRKPLPTAAAQCCHWTY
LGWGEQQTFEDPDSAVDDRDSDYRSETSNSIPPPYHTTSQPNASVHQFPVPVRLPQQLLL
QGNSRDSCNDSMQSYDLDYPERRALSPTSSSRYGSSCNVSQGSSQLSEIDQCHEQDDDHR
ERDSIHSCHSSGSFSRDGQVGFGEQEKALEVTGEEEKGRACEPKERKEDATIHPPPDLVL
HKDHILGPQESFPEENASSPFTQARTHWIRAVTKVRLRLQEIPDDGHPSLPQWLPEGPAG
GLYGIDSMPDLRRKKPLPLVSDLSLVQSRKAGISSAMATRTSLKDEELKSHVYKKTLQAL
IYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCL
QRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVGKVAHVQQMKTVK
QSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVWE
EKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYN
LEKRTDKSAVSGAIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVLIPEA
RGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANI
NAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQ
DLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQ
LKQELPPEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTLVLNQFPQELNVGKVSAEVMW
QLFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYPVWFEQF
VLQWLDENEDVSLEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLEC
PDPNILAHYMRRFAKTIGKVLMQYANILSKSFPDYCTKEKMPCILMNNMQQLRVQLEKMF
EAMGGKELDPEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGPG
NASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMI
VLPPLTDQTGTQLIFTAAKELSHLSKLKDHMVREETRSLTPKQCAVLDLALDTIKQYFHA
GGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQGSGVDDPVGEVSIQVD
LFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWA
PKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVLGLAVMPLRDVAAKGSCACWCPL
GRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRSIEEGS
NT seq 4812 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgctctgtgtacgcgttaaaagagccaaattccagggttcaccagataaattt
aatacatatgtgaccctgaaagtgcagaatgtgaagagcacaactgtagcagttcgtggt
gatcagccttcttgggaacaagattttatgtttgagattagtcgcctggacctgggtcta
agtgtggaggtatggaacaaaggactgatctgggacaccatggtggggaccgtgtggatt
gcactgaagactgttcgtcagtcggatgaggaagggcccggagagtggtccacgttggaa
gcagagacattgatgaaagatgatgagatctgtggaactaaaaacccaactcctcataag
attttgcttgatacaagatttgagttgccttttgatatcccagaggaggaagccagatat
tggacctacaaattggaacaaatcaatgtcttgggagctgacagtgagtattctagtcaa
gaagaaagccggaggaagccattacccactgctgccgcccagtgttgtcactggacctat
ttgggctggggagagcagcagacttttgaagatcctgacagtgccgttgatgaccgagat
agtgactatcgcagtgagaccagcaatagcatcccacctccttaccatacgacttcccag
cccaacgcttctgtgcaccagttccctgtgccagtgcgactgccacagcagctgctactt
cagggcaattcccgagattcctgcaatgactctatgcaaagttacgatcttgattatcca
gagcggcgggccctcagccccaccagcagtagtaggtatggctcctcctgtaatgtaagt
caaggaagctctcagttgagtgaaatagaccagtgtcacgaacaagatgacgaccatcgg
gagagggactcgattcattcatgccacagctctggcagcttctccagagacggccaagtg
ggttttggagaacaagagaaagccttggaggtgacaggtgaagaagagaaggggagagca
tgtgaacccaaggagaggaaagaagatgccacaatccatcctcccccagatctggtgcta
cacaaagaccacatcctaggcccccaggagagttttcctgaggagaatgcttcttcgcca
tttacccaagccagaacacactggatccgagcagttaccaaggttcgactccggctgcag
gagattccagatgatggtcacccctccttgccccagtggctcccggaaggaccagctgga
gggctttatggcattgacagcatgccagatctacgcagaaagaagccactgccgcttgtc
agtgatctgtcattggtccagtcccggaaggcagggatttcttctgcaatggctacacgc
acctctctcaaggatgaagagctgaaatcccatgtgtataagaaaaccctgcaggcctta
atctaccccatctcgtgcaccacaccccacaactttgaggtctggacggccactaccccg
acctactgctatgagtgtgaaggtctgctctggggcattgcccgccagggcatgcgctgc
agcgagtgtggagtcaagtgccatgagaagtgccaggacctgctcaacgccgactgcctg
cagcgggctgcagaaaagagttctaaacatggagctgaggaccggacccagaacataatc
atggccatgaaggaccgcatgaagatccgagagcggaataagccagagatctttgaggtt
atccgagatgtctttactgtgggcaaagttgcccatgtgcaacagatgaaaacagtgaag
cagagtgtactggatggcacctccaaatggtcggccaaaattaccatcactgtggtgtgt
gcccagggcctacaagccaaggacaagaccggatccagtgacccttacgtgactgtacaa
gtgggcaaaaccaagaagcgtaccaagactatttttgggaacctgaatcctgtttgggaa
gagaagttccattttgagtgccacaactcttctgaccgcattaaggtacgtgtatgggat
gaggatgatgacatcaagtcgagagtaaagcagcggctaaagcgagagtctgatgatttc
cttggccaaaccattattgaggttcggacactgagtggcgagatggatgtctggtacaac
ttggagaagaggacagataaatcagctgtctcaggggctatccgactacaaatcagtgtg
gagatcaagggggaggagaaggtagcaccgtatcatgtgcagtatacgtgtctccatgag
aaccttttccattacctcacagacattcagggtagtggaggagtcctgatccctgaggct
cgaggggacgatgcgtggaaggtgtactttgatgagactgcccaagaaattgtggatgaa
tttgccatgcgctatggcatcgagtccatatatcaggccatgacgcactttgcgtgtttg
tcatccaagtacatgtgtcctggtgtgccagcagtgatgagcaccttactggccaacatc
aatgcctactatgcccacacaactgcctccaccaatgtctctgcatctgatcgctttgca
gcttccaactttgggaaagagagatttgtgaaactactggaccagctgcataactcactg
aggattgacctttctacctacaggaataatttccctgctggaagccctgagcggcttcag
gacttgaagtcaacagtggatttgctgaccagcattactttcttcagaatgaaggtgcaa
gaactgcagagccctccaagagccagccaggtggtaaaggattgtgtcaaggcctgtttg
aactccacatatgagtatatcttcaacaactgccatgacctatacagtcgccagtaccag
ctgaaacaggaactacctccagaggaacaaggacccagcattcgaaacctggatttttgg
cccaaactcatcacgctcattgtgtccattatagaagaagataagaattcctacacactc
gttctgaaccagtttcctcaggagttgaatgtgggaaaagtcagcgcagaagtgatgtgg
cagctctttgcccaagacatgaaatatgcactggaggagcatgagaaagaccggctgtgt
aagagtgctgactacatgaacctacacttcaaggtgaagtggctccacaatgaatatgtg
cgagatctgcctgccctccagggacaggtgcctgagtacccagtgtggtttgagcagttt
gtcctgcagtggctggatgaaaatgaggatgtgtccctggaattcctgcgtggggccctg
gaacgagataagaaggatgggttccagcagacatcagagcatgcactcttttcctgctct
gtggtggacgtcttcacacagctcaaccagagcttcgagatcatccggaagctggaatgc
ccagaccccaacatccttgcccactacatgaggagatttgctaagaccatcgggaaggtg
ctgatgcagtatgcaaacatcttatcaaagagcttcccagattactgcacaaaggagaaa
atgccctgcatcctgatgaacaacatgcagcaactgagggtccagctggagaaaatgttt
gaggccatgggaggcaaggagttggaccctgaagctgcagacagtttgaaggagctgcag
gtgaaactgaatacagttctggatgagctcagcatggtatttggaaacagttttcaggtg
cggattgatgagtgtgttcgacaaatggctgacatcctgggccaggtgcggggcccaggg
aatgcatcccccaacgccagggcctcagtggctcaggatgcagacagtgtgctccggcct
ctcatggacttcctggatggcaacctcacactctttgccactgtgtgtgagaagacagtc
ctgaagcgtgtactgaaggagctctggcgggtggtaatgaacacaatggaaagaatgatt
gttctgcccccactcactgaccaaacgggcacccagctgatcttcactgctgccaaggag
ctgagccatctttccaaactcaaggaccacatggtacgagaggaaacccggagtctcact
ccaaagcaatgtgccgtccttgacctcgctctggacaccatcaagcaatacttccatgca
ggaggtaatgggctgaagaaaaccttcctggagaagagcccagatctgcagtccctacgc
tatgccctgtctctgtacacacagaccacagacacactcatcaaaacgtttgtgcgctca
cagactgcccaggggtctggtgtggatgatcctgtgggagaagtctctattcaggtggac
ttgtttacacatcctggaactggagagcacaaggtcacagtgaaagtggtagctgccaat
gacctcaagtggcaaacagcgggtatgttccggccctttgtggaagtgaccatggttggc
ccacaccaaagtgacaagaagaggaagttcacaaccaagtcaaagagcaacaactgggct
cccaagtacaacgagacatttcacttcctcctgggaaatgaagagggaccagaagcctat
gagttgcaaatatgtgtgaaggattactgctttgcccgtgaggatcgtgttctggggctg
gctgtgatgcctctgagggatgtggcagctaagggcagctgtgcttgctggtgccccttg
ggccggaagatccacatggatgagacaggcatgactattctccggattctatctcagaga
agcaatgacgaagtggctcgagagtttgtgaagctcaaatcagagtctcgttccatagaa
gaggggagctga

DBGET integrated database retrieval system