KEGG   Ailuropoda melanoleuca (giant panda): 100472337Help
Entry
100472337         CDS       T01329                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100472337
   00670 One carbon pool by folate
    100472337
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100472337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 187 aa AA seqDB search
MVRTLNCIAAVSQNMGIGKNGDLPWPPLRNEFKFFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINLVLSRDLKEPPQGAHFLAKSLDDALKLIEQPELANKVDIVWIVGGSS
VYKEAMNKPGHLRLFVTRIMQEFESDTFFPEIDLDKYKLLPEYPGVPSDVQEEKGIKYKF
EVYEKND
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtacgctaaactgcatcgccgctgtgtcccagaacatgggcatcggcaagaac
ggggacctgccctggcccccgctcaggaatgaattcaagtttttccaaagaatgaccaca
acctcctcagtagaagggaaacagaatttggtgattatgggtaggaagacatggttctct
attcctgagaagaatcgacctttaaaggacagaattaatttagttctcagcagagacctc
aaggaacctccacaaggagctcattttcttgccaaaagtctggatgatgccttaaaactt
attgagcaaccagaattagcaaataaagtggacatagtttggatagtgggaggcagttct
gtttataaggaagccatgaacaaaccaggccatcttagactatttgtgacaaggattatg
caggaatttgaaagtgacacattttttccagaaattgatttggacaaatacaaacttctg
ccagaatacccaggtgttccttctgatgtccaggaggagaaaggcattaagtacaaattt
gaagtatatgagaagaacgattaa

DBGET integrated database retrieval system