KEGG   Ailuropoda melanoleuca (giant panda): 100472388Help
Entry
100472388         CDS       T01329                                 

Definition
mitogen-activated protein kinase 3-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Adherens junction
Gap junction
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Aldosterone-regulated sodium reabsorption
Alzheimer's disease
Prion diseases
Alcoholism
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100472388
   04015 Rap1 signaling pathway
    100472388
   04010 MAPK signaling pathway
    100472388
   04012 ErbB signaling pathway
    100472388
   04350 TGF-beta signaling pathway
    100472388
   04370 VEGF signaling pathway
    100472388
   04668 TNF signaling pathway
    100472388
   04066 HIF-1 signaling pathway
    100472388
   04068 FoxO signaling pathway
    100472388
   04024 cAMP signaling pathway
    100472388
   04022 cGMP - PKG signaling pathway
    100472388
   04151 PI3K-Akt signaling pathway
    100472388
   04150 mTOR signaling pathway
    100472388
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100472388
  Cell growth and death
   04114 Oocyte meiosis
    100472388
  Cellular commiunity
   04510 Focal adhesion
    100472388
   04520 Adherens junction
    100472388
   04540 Gap junction
    100472388
 Organismal Systems
  Immune system
   04611 Platelet activation
    100472388
   04620 Toll-like receptor signaling pathway
    100472388
   04621 NOD-like receptor signaling pathway
    100472388
   04650 Natural killer cell mediated cytotoxicity
    100472388
   04660 T cell receptor signaling pathway
    100472388
   04662 B cell receptor signaling pathway
    100472388
   04664 Fc epsilon RI signaling pathway
    100472388
   04666 Fc gamma R-mediated phagocytosis
    100472388
   04062 Chemokine signaling pathway
    100472388
  Endocrine system
   04910 Insulin signaling pathway
    100472388
   04912 GnRH signaling pathway
    100472388
   04915 Estrogen signaling pathway
    100472388
   04914 Progesterone-mediated oocyte maturation
    100472388
   04917 Prolactin signaling pathway
    100472388
   04921 Oxytocin signaling pathway
    100472388
   04919 Thyroid hormone signaling pathway
    100472388
   04916 Melanogenesis
    100472388
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100472388
   04270 Vascular smooth muscle contraction
    100472388
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100472388
  Nervous system
   04724 Glutamatergic synapse
    100472388
   04725 Cholinergic synapse
    100472388
   04726 Serotonergic synapse
    100472388
   04720 Long-term potentiation
    100472388
   04730 Long-term depression
    100472388
   04723 Retrograde endocannabinoid signaling
    100472388
   04722 Neurotrophin signaling pathway
    100472388
  Development
   04320 Dorso-ventral axis formation
    100472388
   04360 Axon guidance
    100472388
   04380 Osteoclast differentiation
    100472388
  Environmental adaptation
   04713 Circadian entrainment
    100472388
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100472388
   05205 Proteoglycans in cancer
    100472388
   05203 Viral carcinogenesis
    100472388
   05210 Colorectal cancer
    100472388
   05212 Pancreatic cancer
    100472388
   05214 Glioma
    100472388
   05216 Thyroid cancer
    100472388
   05221 Acute myeloid leukemia
    100472388
   05220 Chronic myeloid leukemia
    100472388
   05218 Melanoma
    100472388
   05211 Renal cell carcinoma
    100472388
   05219 Bladder cancer
    100472388
   05215 Prostate cancer
    100472388
   05213 Endometrial cancer
    100472388
   05223 Non-small cell lung cancer
    100472388
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100472388
   05020 Prion diseases
    100472388
  Substance dependence
   05034 Alcoholism
    100472388
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100472388
  Infectious diseases
   05132 Salmonella infection
    100472388
   05133 Pertussis
    100472388
   05152 Tuberculosis
    100472388
   05164 Influenza A
    100472388
   05161 Hepatitis B
    100472388
   05160 Hepatitis C
    100472388
   05145 Toxoplasmosis
    100472388
   05140 Leishmaniasis
    100472388
   05142 Chagas disease (American trypanosomiasis)
    100472388
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100472388
Protein kinases [BR:aml01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100472388
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100472388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 324 aa AA seqDB search
MHSAYDHVRKIRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAM
RDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLIN
TTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCIL
AEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKL
FPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDL
PKERLKELIFQETARFQPGALEAP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcactcagcttacgaccacgtgcgcaagattcgcgtggccatcaagaaaatcagcccc
ttcgagcatcagacctactgccagcgcacactgcgggagatccagatcttgctgcgcttc
cgccacgagaacgtcattggcattcgggacattctgcgggcgcccaccctggaagccatg
agagatgtctacattgtgcaggacctgatggagacagacctgtacaagttgctcaaaagc
cagcagctgagcaacgaccatgtttgctacttcctctaccagatcctgcggggcctcaag
tatatccactcagccaacgtgctccaccgggatctaaagccctccaacctgcttatcaac
accacctgcgaccttaagatctgcgattttggcctggcccggattgcggaccctgagcat
gaccacaccggcttcctgacagaatatgtggccacacgctggtaccgggctccagaaatc
atgcttaactctaagggctacaccaagtccatcgacatctggtctgtgggctgcattctg
gctgagatgctctccaaccggcccatcttccctggcaagcactacctggaccagctcaac
cacattctgggtatcctcggctccccatcccaggaggacttgaattgtatcatcaatatg
aaggcccgaaactacctgcagtctctgccctccaagaccaaggtggcctgggccaagctt
tttcccaagtcggactcaaaagcccttgacctgctagaccggatgttgacctttaacccc
aacaaacggatcacagtggaagaagcactggctcacccctacttggagcagtactacgac
ccaacagatgagccagtggccgaggagcctttcacctttgacatggagctggatgatcta
cccaaggagcggctgaaggagctcatcttccaggagacagcccgcttccagcctggggcg
ctggaggccccctaa

DBGET integrated database retrieval system