KEGG   Ailuropoda melanoleuca (giant panda): 100472443Help
Entry
100472443         CDS       T01329                                 

Gene name
USP38
Definition
ubiquitin specific peptidase 38
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.4.19.12]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100472443 (USP38)
Peptidases [BR:aml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100472443 (USP38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1042 aa AA seqDB search
MDKILEGLVSSSHPLPLKRVIVRKVVESAEHWLDEAQCEAMFDLTTRLILEGQDPFQRQV
GHQVLEAYARYHRPEFESFFNKTFVLGLLQQGYHSLDRKDVAILDYIHNGLKLIMSCPSV
LDLFSLLQVEVLRMVCERPEPQLCARLSDLLTDFVQCIPKGKLSITFCQQLVRTIGHFQC
VSTQEKELREYVSQVTKVSNLLQNIWKAEPSTLLPSLQEVFASISSTDTSFEPSVALASL
VQHIPLQMITVLIRSLTTDPNVKDASMTQALCRMIDWLSWPLAQHVDTWVIALLKGLAAV
QKFTILIDVTLLKIELVFNRLWFPLVRPGALAVLSHMLLSFQHSPEAFHLIVPHIVNLVH
SFKSDGLPSSTAFLVQLTELIQCMMYHYSGFPDLYEPILEAIKDFPKPSEEKIKLILNQS
AWTSQSNSLASCLSRLSGKSETGKTGLINLGNTCYMNSVIQALFMATDFRRQVLSLNLNG
CNSLMKKLQHLFAFLAHTQREAYAPRVFFEASRPPWFTARSQQDCSEYLRFLLDRLHEEE
KILKVQSSHKPSESLGCNVTSSQEVASKAAVLTESPCTSDGEKTLIEKMFGGKLRTHICC
LNCRSTSQKVEAFTDLSLAFCPSSSIEKLSFQDAASSPNTQDGGLMQANVPGPTEEPGVY
NPATAAFVCDSAMNERMLGSPSDEFRCTENTCVPNESSRILVNKDVPQKPGGGNTPSVTD
LLNYFLAPEILTGDNQYYCENCASLQNAEKTMQITEEPEYLILTLLRFSYDQKYHVRRKI
LDNVSLPLVLELPVKRTTSFSSLSESWSIDVDFTGISENLAKKLKPSGTEETCCSRLVPY
LLSSIVVHSGVSSESGHYYSYARNITGTESSYQMCHQSETRALASSQSHLLGRNSLSAVI
EQDLENKEMSKEWFLFNDSRVTFTSFQSVQKITSRFPKDTAYVLLYKKQNSTNSLSGSSS
TSGLWVNGDPPLQKELMDAITKDNKLYLQEQELNARARALQAASASCSFRPNGFDDNDPP
GSCGPTGGGGGGGFNTVGRLVF
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggagggcctggtgagttcttcgcacccactgcccctaaagcgggtg
attgtgcggaaggtggtggaatcggcggagcattggctagacgaagcgcagtgtgaagcc
atgtttgacctgactacccggctcatcctggagggccaagacccctttcagcggcaggtg
gggcaccaagtgctggaagcctacgcacgataccaccggccggagttcgagtccttcttc
aacaagacattcgtgttgggcctccttcagcagggctaccactcgctggacaggaaggac
gtagccattctggactacattcacaacggcctgaagctgatcatgagctgcccatccgtg
ctggacctcttcagcctgctgcaagtggaggtgctacgcatggtgtgtgagcggccggag
ccgcagctgtgcgcccgattgagcgacctcctgaccgacttcgtgcagtgcatacccaaa
ggaaaattgtccatcaccttctgtcaacagcttgttcgaacaataggccatttccagtgc
gtgtccacccaggagaaggagctgcgggaatatgtctctcaggtgacaaaagtgagtaac
ttgctgcagaacatctggaaggccgagccttccacactactgccttccctgcaagaagtt
tttgcaagcatttcttccacagatacatcatttgaaccttctgtagcattggcaagcctt
gtgcagcatattcctcttcagatgattacagttctcatcaggagcctaactacggatcca
aatgtaaaagatgcaagtatgacccaagctctttgcagaatgattgactggctatcctgg
ccattggctcagcatgtggatacatgggtgattgcactcctaaaaggactggcagctgtc
cagaagtttactattttgatagatgttactttactgaaaatagaactggtttttaatcga
ctttggtttcctcttgtgagacctggtgctcttgcagttctttctcacatgctgctcagt
tttcagcattctccagaggcattccatctgattgttcctcacatagttaatttggttcac
tccttcaaaagcgatggtctgccttccagtacagccttcttagtgcagttaacagaactg
atacagtgtatgatgtatcattattctggatttccagatctctatgaacctattttggaa
gcaataaaggattttcctaagcccagtgaagagaagattaaattgattctcaatcaaagt
gcctggacttctcaatccaattctttggcctcctgcttgtctagactttctggaaaatct
gaaactgggaaaactggtcttattaatctaggaaatacatgttatatgaacagtgttata
caagcattgtttatggctacagatttcaggagacaagtattatctttaaatttaaatggg
tgcaattcattaatgaaaaaattacagcatctctttgcctttttggctcatacacagaga
gaagcatatgcacctcgggtattctttgaggcttctagacctccatggtttaccgccaga
tcacagcaagactgttctgaatacctcaggtttctgctagacaggctacatgaagaagaa
aagatcttgaaagttcagtcctcacacaagccttctgaaagtctggggtgcaatgtaact
tcttcacaggaagtagccagtaaggcagctgtactaacagaaagcccttgcacaagtgat
ggtgagaagactttaatagaaaaaatgtttggaggaaaactacgaactcacatatgttgt
ttgaactgcaggagtacctcacaaaaagtggaagcctttaccgatctttcactggccttt
tgtccttcctcttctatcgaaaagttgtcttttcaagatgcagcatcatcacccaataca
caagatggtggtctaatgcaagccaatgtacctggtcctactgaagaaccaggagtttat
aatccagcaacagctgcctttgtttgtgactcagctatgaatgaaagaatgttaggcagt
ccttctgatgagtttcgctgtactgaaaacacttgtgtccccaatgaatctagcaggatt
cttgttaataaagatgtacctcagaaaccaggaggtggaaacacaccttcagtaactgac
ttactaaattattttttggctccagagattcttactggcgacaaccagtattattgtgaa
aactgtgcctctttgcagaatgccgagaaaactatgcaaatcacggaggagcctgagtac
cttattcttactctcctgagattttcatatgatcaaaagtatcatgtgagaagaaaaatt
ttagacaatgtgtcactgccactggttttggagttgccagttaaaagaactacttctttc
tcttcattgtcagaaagttggtctatagatgttgacttcactggtatcagtgagaaccta
gctaaaaaattaaagccttctggaactgaagaaacttgctgctccagattggtgccatat
ctattaagttctattgttgttcattctggtgtgtcctctgaaagcgggcattactattcc
tacgccagaaacatcacaggtacagagtcctcataccagatgtgccatcagtctgaaact
cgggcgctagcgtcctcccagagtcatttactagggagaaatagtctcagtgcagttatt
gaacaggatttagaaaataaggagatgtcaaaagaatggtttttatttaatgacagcaga
gtgacatttacttcatttcagtcagtccagaaaattacgagtaggtttccaaaggacaca
gcttatgtgcttttgtataaaaaacagaacagcactaacagtttaagtggtagcagctca
accagtggactctgggtaaatggagacccacctctacagaaagaacttatggatgctata
acaaaagacaataaactgtatttacaggaacaagagttgaacgctcgagcgcgggcccta
caagctgcatctgcctcctgttcatttcgccccaatggatttgatgacaatgacccacca
ggaagctgtggaccaactggtggagggggtggaggaggatttaatacagttggcagactc
gtattttga

DBGET integrated database retrieval system