KEGG   Ailuropoda melanoleuca (giant panda): 100472452Help
Entry
100472452         CDS       T01329                                 

Definition
cytochrome P450 2D15-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100472452
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100472452
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100472452
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP2 family
   100472452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MGLLTRDLLGPLAIALAVFLLLLNLMQRRGCWAARYPPGPTPLPLLGNLLQMDFQNTLGY
FDQLRHRFGNVFSLQLAWTPVVVLNGLDAVREALVCHSEDTADRPPMPIYEHLGFGPHSQ
GVILARYGREWREQRRFSLSMLRNFGLGKRSLEQWVAEEASCLCEAFADHAGRPFSPRAL
VDKAVSNVISSLTFGRRFEYDDPRFLKLLDRLQAGVEEDQGFLHEFLNSVPVLLRIPGLA
SKVFSAQKALMALTDELIQECRMTWDPTQPPRDLTDAFLNEIEKAKGSPESSFNDENLRI
VISDLFAAGMVSTSTTLTWALLLMVLHPDVQRRVQQEIDEVIGRVQQPEMGNQTRMPFTM
AVVHEVQRFGDIVPLGLPHMTSRDTEVQGFLIPKGTRIIANLSSVLKDEKIWKKPFRFYP
EHFLDAQGRFVKQEAFMPFSAGRRVCLGEPLARMELLLFFAWLLQRFGFSVPAGQPXPSD
HGVCSFLVAPAPYQLCAVPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgaccagggatctgctggggccgctggccatagccttggccgtcttcctg
ctcctgctgaacctgatgcagagacgcgggtgctgggctgcccgctacccgccgggcccc
acgccgctgcccctgctgggcaacctgctgcagatggacttccagaacacactcggctac
tttgaccagctgcggcaccgcttcgggaacgtgttcagcctgcagctggcctggacgccc
gtggttgtgctcaacggcctggacgccgtgcgcgaggcactcgtgtgccacagcgaggac
acagccgaccgtccgccaatgcccatctatgagcacctgggtttcgggccgcactcccaa
ggggtgatcctggcgcgctacgggcgcgagtggcgcgagcagcggcgcttctccttgtcc
atgctgcgcaacttcggcctgggcaagaggtcactggagcagtgggtggccgaggaggcc
tcgtgcctctgtgaagccttcgccgaccatgccggacgccccttcagccccagagccctc
gtggataaagcggtgagcaacgtgatctcttccctcaccttcgggcgccgcttcgagtac
gacgacccgcgcttcctcaagctgctggaccgactgcaggcgggagtggaggaggaccag
ggcttcctgcacgagttcctgaactccgtccccgtgctcctgcgcatccctgggctggcc
agcaaggtcttctcggcacagaaggccctcatggccctaacagatgagctaatccaggaa
tgcaggatgacctgggacccgacccagccaccccgagacctgactgacgccttcctgaat
gagatagaaaaggccaaggggagccccgagagcagcttcaatgatgagaacctgcgcata
gtgatatctgacctgttcgctgctggcatggtgtccacctcaaccacgctgacctgggcc
ctcctgctcatggtcctgcacccggatgtgcagcgacgcgtccaacaggagatagatgag
gtgatagggcgggtgcagcaaccagagatggggaaccagacccgcatgcccttcaccatg
gccgtggtccatgaggtgcagcgttttggggacatcgtcccactgggcttgccccacatg
acgtcccgggacactgaagtgcagggcttcctcatccccaaggggacaagaattatcgcc
aacctatcatcagtgctgaaggacgagaagatctggaagaagcccttccgtttctacccc
gagcacttcctggatgcccagggccgattcgtcaagcaggaggccttcatgcccttctcc
gcaggccgccgtgtctgcctcggggagcccctggcccgcatggagctcttgctcttcttc
gcctggctcctgcagcgcttcggcttctcggtgcctgccgggcagccgnngcccagcgac
cacggagtctgctccttcctggtggccccagccccctaccagctctgtgccgtgcctcgc
tag

DBGET integrated database retrieval system