KEGG   Ailuropoda melanoleuca (giant panda): 100472452Help
Entry
100472452         CDS       T01329                                 

Definition
cytochrome P450 2D15-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:aml00140]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:aml04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MGLLTRDLLGPLAIALAVFLLLLNLMQRRGCWAARYPPGPTPLPLLGNLLQMDFQNTLGY
FDQLRHRFGNVFSLQLAWTPVVVLNGLDAVREALVCHSEDTADRPPMPIYEHLGFGPHSQ
GVILARYGREWREQRRFSLSMLRNFGLGKRSLEQWVAEEASCLCEAFADHAGRPFSPRAL
VDKAVSNVISSLTFGRRFEYDDPRFLKLLDRLQAGVEEDQGFLHEFLNSVPVLLRIPGLA
SKVFSAQKALMALTDELIQECRMTWDPTQPPRDLTDAFLNEIEKAKGSPESSFNDENLRI
VISDLFAAGMVSTSTTLTWALLLMVLHPDVQRRVQQEIDEVIGRVQQPEMGNQTRMPFTM
AVVHEVQRFGDIVPLGLPHMTSRDTEVQGFLIPKGTRIIANLSSVLKDEKIWKKPFRFYP
EHFLDAQGRFVKQEAFMPFSAGRRVCLGEPLARMELLLFFAWLLQRFGFSVPAGQPXPSD
HGVCSFLVAPAPYQLCAVPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgaccagggatctgctggggccgctggccatagccttggccgtcttcctg
ctcctgctgaacctgatgcagagacgcgggtgctgggctgcccgctacccgccgggcccc
acgccgctgcccctgctgggcaacctgctgcagatggacttccagaacacactcggctac
tttgaccagctgcggcaccgcttcgggaacgtgttcagcctgcagctggcctggacgccc
gtggttgtgctcaacggcctggacgccgtgcgcgaggcactcgtgtgccacagcgaggac
acagccgaccgtccgccaatgcccatctatgagcacctgggtttcgggccgcactcccaa
ggggtgatcctggcgcgctacgggcgcgagtggcgcgagcagcggcgcttctccttgtcc
atgctgcgcaacttcggcctgggcaagaggtcactggagcagtgggtggccgaggaggcc
tcgtgcctctgtgaagccttcgccgaccatgccggacgccccttcagccccagagccctc
gtggataaagcggtgagcaacgtgatctcttccctcaccttcgggcgccgcttcgagtac
gacgacccgcgcttcctcaagctgctggaccgactgcaggcgggagtggaggaggaccag
ggcttcctgcacgagttcctgaactccgtccccgtgctcctgcgcatccctgggctggcc
agcaaggtcttctcggcacagaaggccctcatggccctaacagatgagctaatccaggaa
tgcaggatgacctgggacccgacccagccaccccgagacctgactgacgccttcctgaat
gagatagaaaaggccaaggggagccccgagagcagcttcaatgatgagaacctgcgcata
gtgatatctgacctgttcgctgctggcatggtgtccacctcaaccacgctgacctgggcc
ctcctgctcatggtcctgcacccggatgtgcagcgacgcgtccaacaggagatagatgag
gtgatagggcgggtgcagcaaccagagatggggaaccagacccgcatgcccttcaccatg
gccgtggtccatgaggtgcagcgttttggggacatcgtcccactgggcttgccccacatg
acgtcccgggacactgaagtgcagggcttcctcatccccaaggggacaagaattatcgcc
aacctatcatcagtgctgaaggacgagaagatctggaagaagcccttccgtttctacccc
gagcacttcctggatgcccagggccgattcgtcaagcaggaggccttcatgcccttctcc
gcaggccgccgtgtctgcctcggggagcccctggcccgcatggagctcttgctcttcttc
gcctggctcctgcagcgcttcggcttctcggtgcctgccgggcagccgnngcccagcgac
cacggagtctgctccttcctggtggccccagccccctaccagctctgtgccgtgcctcgc
tag

DBGET integrated database retrieval system