KEGG   Ailuropoda melanoleuca (giant panda): 100472573Help
Entry
100472573         CDS       T01329                                 

Gene name
PFN4
Definition
(RefSeq) profilin family, member 4
  KO
K05759  
profilin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100472573 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100472573 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100472573 (PFN4)
Exosome [BR:aml04147]
 Exosomal proteins
  Proteins found in most exosomes
   100472573 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 129 aa AA seqDB search
MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSIMPGDVRTLVNGFAKNPLQTR
REGLYFKEKDYKCIRADDYSLYAKNENTGVIVVKTHMYLLVATYTEGMYPSVCVEATEKL
GEYLRKKGN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatctgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt
gcagccctcatcaaactccaagaacgaagcttgtgtgtagcatcaccaggatttagtata
atgcctggtgatgtccgaacacttgtgaatggattcgccaagaaccctttgcaaaccaga
agagaaggattgtatttcaaggaaaaggactacaaatgtatccgggcagatgactattct
ctttatgctaagaatgaaaacactggtgtgattgttgtgaagacccatatgtatcttctg
gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaagctg
ggagaatatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system